Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cercopithecine herpesvirus 1 Envelope glycoprotein D (gD)

This Recombinant Cercopithecine herpesvirus 1 Envelope glycoprotein D (gD) spans the amino acid sequence from region 18-395.

Product Specifications

Product Name Alternative

Envelope glycoprotein D, gD

UniProt

P36342

Expression Region

18-395

Origin

Cercopithecine herpesvirus 1 (CeHV-1) (Simian herpes B virus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

RVPAGEGEYVPVERSLTRVNPGRFRGAHLPPLEQKTDPPDVRRVYHVQPFVENPFQTPSV PVAVYYAVLERACRSVLLWAPTEAVQVVRGAPEATRSDARYNLTVAWYRTSDDCAIPILV MEYAECQYDKPLGACPVRNLPRWSFYDSFSATGDDDLGLLMHAPAFETAGTYVRLVKVNG WVEVTQFIFEHRGKGPCRYTLPLRILPAACLRAPVFEQGVTVDAIGMLPRFIPENQRIVA VYSLQAAGWHGPKAPFTSTLLPPEVVETANVTRPELAPEERGTSRTPGDEPAPAVAAQLP PNWHVPEASDVTIQGPAPAPSGHTGAVVGALAGAGLAAGVVVLAVYLVRRRGRAAGKHVR LPELLEEAHGPARRGAPY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Thyroid gland
CB610121 1 Block

Frozen Tissue Blocks, Thyroid gland

Sign In for Pricing
View Details
Zfp959 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4977807 1.0 µg DNA

Zfp959 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis 35 kDa protein (Rv2744c, MT2815)
MBS1086436-01 0.02 mg (E-Coli)

Recombinant Mycobacterium tuberculosis 35 kDa protein (Rv2744c, MT2815)

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis 35 kDa protein (Rv2744c, MT2815)
MBS1086436-02 0.02 mg (Yeast)

Recombinant Mycobacterium tuberculosis 35 kDa protein (Rv2744c, MT2815)

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis 35 kDa protein (Rv2744c, MT2815)
MBS1086436-03 0.1 mg (E-Coli)

Recombinant Mycobacterium tuberculosis 35 kDa protein (Rv2744c, MT2815)

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis 35 kDa protein (Rv2744c, MT2815)
MBS1086436-04 0.1 mg (Yeast)

Recombinant Mycobacterium tuberculosis 35 kDa protein (Rv2744c, MT2815)

Sign In for Pricing
View Details