Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Equus caballus Interleukin-13 (IL13)

Product Specifications

Abbreviation

Recombinant Horse IL13 protein

Gene Name

IL13

UniProt

B6C802

Expression Region

21-133aa

Organism

Equus caballus (Horse)

Target Sequence

APLPSSMALKELIKELVNITQNQAPLCNGSMVWSVNLTADTYCRALESLSNVSTCSAIQNTRKMLTKLCPHQLSAGQVSSERARDTKIEVIVLVKDLLKNLRKIFHGGKHVDA

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Cancer

Relevance

Cytokine. Inhibits inflammatory cytokine production. Synergizes with IL2 in regulating interferon-gamma synthesis. May be critical in regulating inflammatory and immune responses. Positively regulates IL31RA expression in macrophages.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

13.9 kDa

References & Citations

"The complete equine interleukin-13 cDNA sequence." Wagner B., de Mestre A.M. Submitted (JUN-2007) to the EMBL/GenBank/DDBJ databases

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ubr5 Mouse Gene Knockout Kit (CRISPR)
KN518622 1 Kit

Ubr5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Topoisomerase I, Mitochondrial (TOP1MT) (TOP1MT/2883R), CF594 conjugate, 0.1mg/mL
BNC942883-100 1x 100 µL

Topoisomerase I, Mitochondrial (TOP1MT) (TOP1MT/2883R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD56 / NCAM (123A8, same as 56C04), 0.2mg/mL
BNUB0692-500 1x 500 µL

CD56 / NCAM (123A8, same as 56C04), 0.2mg/mL

Sign In for Pricing
View Details
HLA-DP/-DQ/-DR (MHC II) (CR3/43), Biotin conjugate, 0.1mg/mL
BNCB1656-500 1x 500 µL

HLA-DP/-DQ/-DR (MHC II) (CR3/43), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MEOX2 Rabbit Polyclonal Antibody
HA500053 100 µL

MEOX2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Colloidal Gold Conjugated Sambucus nigra (Elderberry Bark) -SNA-II-,  10nm
GP-6803-10 1 mL

Colloidal Gold Conjugated Sambucus nigra (Elderberry Bark) -SNA-II-, 10nm

Sign In for Pricing
View Details