Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-3, Human (His)

IL-3 protein is mainly secreted by T lymphocytes, mast cells and osteoblasts and is critical for the generation and differentiation of hematopoietic progenitor cells. It stimulates mature basophils, eosinophils and monocytes, promoting functional activation. IL-3 Protein, Human (His) is the recombinant human-derived IL-3 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-3 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-3-protein-human-his.html

Purity

98.0

Smiles

APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

Molecular Formula

3562 (Gene_ID) P08700 (A20-F152) (Accession)

Molecular Weight

Approximately 13-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cxxc5 Mouse Gene Knockout Kit (CRISPR)
KN304060 1 Kit

Cxxc5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SRARP Human qPCR Primer Pair (NM_178840)
HP218916 200 Reactions

SRARP Human qPCR Primer Pair (NM_178840)

Sign In for Pricing
View Details
Mouse Anti-Mouse PD-1 (RMP1-14) Recombinant Antibody D265A
ICH1182D265A-10mg 10 mg (2x 5 mg)

Mouse Anti-Mouse PD-1 (RMP1-14) Recombinant Antibody D265A

Sign In for Pricing
View Details
Signal sequence receptor delta (SSR4) Mouse Monoclonal Antibody [Clone ID: AT26G5]
AM50071PU-S 50 µL

Signal sequence receptor delta (SSR4) Mouse Monoclonal Antibody [Clone ID: AT26G5]

Sign In for Pricing
View Details
SPATA13 Rabbit Polyclonal Antibody
ER1902-32 100 µL

SPATA13 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
1-Bromo-3-ethylbenzene
TRC-B685840-2.5G 2.5 g

1-Bromo-3-ethylbenzene

Sign In for Pricing
View Details