Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OBP2B, Human (HEK293, His)

The OBP2B protein may be involved in the binding and transport of small hydrophobic volatile molecules, suggesting a role in molecular recognition and transport, especially for lipophilic compounds. Its specificity implies involvement in sensory or signaling pathways in which recognition and transport of volatile compounds are crucial. OBP2B Protein, Human (HEK293, His) is the recombinant human-derived OBP2B protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

OBP2B Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/obp2b-protein-human-hek293-his.html

Purity

98.0

Smiles

LSFTLEEEDITGTWYVKAMVVDKDFPEDRRPRKVSPVKVTALGGGKLEATFTFMREDRCIQKKILMRKTEEPGKYSAYGGRKLMYLQELPRRDHYIFYCKDQHHGGLLHMGKLVGRNSDTNREALEEFKKLVQRKGLSEEDIFTPLQTGSCVPEH

Molecular Formula

29989 (Gene_ID) Q9NPH6-1 (L16-H170) (Accession)

Molecular Weight

Approximately 20 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EPN2-IT1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV724247 1.0 µg DNA

EPN2-IT1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Lentiviral human CCR7 shRNA (UAS) - Lentiviral human CCR7 shRNA (UAS, iRFP) plasmid
GTR15308095 1 Vial

Lentiviral human CCR7 shRNA (UAS) - Lentiviral human CCR7 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Angiotensinase C CRISPR Activation Plasmid (m2)
sc-428347-ACT-2 20 µg

Angiotensinase C CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
TNFRSF4 Mouse Monoclonal Antibody [Clone ID: LBI2F12A2]
AMM20706V 100 µL

TNFRSF4 Mouse Monoclonal Antibody [Clone ID: LBI2F12A2]

Sign In for Pricing
View Details
CD68 Rabbit Polyclonal Antibody (Biotin)
orb2094223 100 µL

CD68 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
NUDT6 Mouse Monoclonal Antibody [Clone ID: OTI10B4]
TA502355 100 µL

NUDT6 Mouse Monoclonal Antibody [Clone ID: OTI10B4]

Sign In for Pricing
View Details