Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

M1R Recombinant Protein

Product Specifications

Background

Monkeypox is a rare zoonosis caused by monkeypox virus, which has become the most serious orthpoxvirus and consists of complex double stranded DNA. The cases are mostly in central and western Africa. The pathogenesis of monkeypox is that the virus invades the body from respiratory mucosa , multiplies in lymphocytes, and incurs into blood producing transient venereal toxemia. after the virus multiplies in cells, the cells can invade the blood and propagate to the skin of the whole body, causing lesions.

CAS Number

9000-83-3

Swiss Prot

Q80KX3

Modification Site

NdeI-XhoI

Expression System

Pet-22b (+)

Tag

His-tag; Sumo-Tag

Purity

Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~31kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only, not for use in diagnostic procedure.

Host or Source

E.coli

AA Sequence

HMGAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNITVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPRQVAGLE

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal VAC14 Antibody [Alexa Fluor 700]
NBP2-44278AF700 0.1 mL

Rabbit Polyclonal VAC14 Antibody [Alexa Fluor 700]

Ask
View Details
Mouse Monoclonal ICAM-1/CD54 Antibody (MEM-111) [Alexa Fluor 350]
NB500-318AF350 0.1 mL

Mouse Monoclonal ICAM-1/CD54 Antibody (MEM-111) [Alexa Fluor 350]

Ask
View Details
GENLISA™ Human SPRY domain-containing SOCS box Protein 3 (SPSB3) ELISA
KBH3180 1x 96 Well

GENLISA™ Human SPRY domain-containing SOCS box Protein 3 (SPSB3) ELISA

Ask
View Details
Ephx1 Mouse shRNA Lentiviral Particle (Locus ID 13849)
TL500621V 500 µL Each

Ephx1 Mouse shRNA Lentiviral Particle (Locus ID 13849)

Ask
View Details