Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD319 Recombinant Protein

Product Specifications

Background

CRACC/SLAMF7/CD319 (also known as CS1) is a member of the signaling lymphocytic activation molecule (SLAM) family. It is a single-pass type l transmembrane glycoprotein expressed on NK cells, subsets of mature dendritic cells, activated B and T lymphocytes, but not in promyelocytic B or T cell lines. Expression of this protein has been detected in the spleen, lymph node, peripheral blood leukocytes, bone marrow, small intestine, stomach, appendix, lung, and trachea. Homophilic interactions of CRACC/SLAMF7/CD319 modulate the activity and differentiation of immune cells. CRACC/SLAMF7/CD319 may function as an inhibitory or activating receptor in immune cells depending on cellular context and availability of adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2. In the presence of SH2D1B/EAT-2, CRACC/SLAMF7/CD319 activates NK cells and B cells. T cells lack SH2D1B/EAT-2 expression, and therefore CRACC/SLAMF7/CD319 acts as an inhibitory receptor. In LPS-activated monocytes, CRACC/SLAMF7/CD319 negatively regulates production of proinflammatory cytokines. CRACC/SLAMF7/CD319 is upregulated in multiple myeloma and is implicated in the uncontrolled proliferation of these cells, and thus has become the target for therapeutic intervention. Seven isoforms of CRACC/SLAMF7/CD319 produced by alternative splicing have been identified.

CAS Number

9000-83-3

Swiss Prot

Q9NQ25

Modification Site

NdeI-XhoI

Expression System

Pet-22b (+)

Tag

His-tag

Purity

Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~25kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only, not for use in diagnostic procedure.

Host or Source

E.coli

AA Sequence

SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVD FPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKN GTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVS RNFSSPILARKLCEGAADDPDSSM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fluorescein Isothiocynate Isomer 1
MBS571107-01 100 mg

Fluorescein Isothiocynate Isomer 1

Sign In for Pricing
View Details
Fluorescein Isothiocynate Isomer 1
MBS571107-02 5x 100 mg

Fluorescein Isothiocynate Isomer 1

Sign In for Pricing
View Details
ZWINT (NM_007057) Human Recombinant Protein
PH37147M5 20 µg

ZWINT (NM_007057) Human Recombinant Protein

Sign In for Pricing
View Details
IGKV1-5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV711359 1.0 µg DNA

IGKV1-5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Canine Coiled-coil domain-containing protein 125 (CCDC125) ELISA Kit
MBS7246067-01 48 Well

Canine Coiled-coil domain-containing protein 125 (CCDC125) ELISA Kit

Sign In for Pricing
View Details
Canine Coiled-coil domain-containing protein 125 (CCDC125) ELISA Kit
MBS7246067-02 96 Well

Canine Coiled-coil domain-containing protein 125 (CCDC125) ELISA Kit

Sign In for Pricing
View Details