Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-1RA, Human (HEK293-expressed)

IL-1 Receptor Antagonist, also known as IL-1RA, ICIL-1RA, IRAP and IL-1RN, is a member of the interleukin 1 cytokine family. It is expressed by monocytes, neutrophils, macrophages, epithelial cells and fibroblasts. IL-1RA inhibits the activity of both IL-1alpha and IL-1beta, and modulates a variety of IL-1 related immune and inflammatory responses. It inhibits the activity of IL-1 by binding to the receptor IL-1R1 and preventing its association with the coreceptor IL-1RAP for signaling. Clinical studies are being conducted to investigate the use of IL-1RA in the treatment of sepsis, rheumatoid arthritis and chronic myelogenous leukemia.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 < 0.1 μg /ml, measured in a neutralization assay using D10S cells in the presence of 50pg/ml Human IL-1a.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

18-23 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human IL-1 Receptor Antagonist remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human IL-1 Receptor Antagonist should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

HEK 293

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQL EAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mini Sample Mouse VEGF-A (Vascular Endothelial Cell Growth Factor A) ELISA Kit
E-MSEL-M0005-01 10x 96 Tests

Mini Sample Mouse VEGF-A (Vascular Endothelial Cell Growth Factor A) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse VEGF-A (Vascular Endothelial Cell Growth Factor A) ELISA Kit
E-MSEL-M0005-02 5x 96 Tests

Mini Sample Mouse VEGF-A (Vascular Endothelial Cell Growth Factor A) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse VEGF-A (Vascular Endothelial Cell Growth Factor A) ELISA Kit
E-MSEL-M0005-03 96 Tests

Mini Sample Mouse VEGF-A (Vascular Endothelial Cell Growth Factor A) ELISA Kit

Sign In for Pricing
View Details
Stox1 Mouse Gene Knockout Kit (CRISPR)
KN516900 1 Kit

Stox1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Floor Standing Shaking Incubator BSFT-1803
BSFT-1803 1 Unit

Floor Standing Shaking Incubator BSFT-1803

Sign In for Pricing
View Details
DR5 (TNFRSF10B) Mouse Monoclonal Antibody [Clone ID: DR5-01-1]
AM03099RP-N 100 µg

DR5 (TNFRSF10B) Mouse Monoclonal Antibody [Clone ID: DR5-01-1]

Sign In for Pricing
View Details