Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantCT‑1, Mouse

Cardiotrophin-1 (CT-1) is a member of the cytokine family which also includes IL-6, IL-11, leukemia inhibitory factor (LIF), oncostatin M (OSM), and ciliary neurotrophic factor (CNTF) . CT-1 is associated with the pathophysiology of several types of heart disease including hypertension, myocardial infarction, valvular heart disease, and congestive heart failure. The protein exerts its cellular effects by interacting with the glycoprotein 130 (gp130) /leukemia inhibitory factor receptor beta (LIFR) heterodimer. CT-1 activates phosphatidylinositol 3-kinase (PI-3 kinase) in cardiac myocytes and enhances transcription factor NF-κB DNA -binding activities. CT-1 is highly expressed in the heart, skeletal muscle, prostate and ovary and to lower levels in lung, kidney, pancreas, thymus, testis and small intestine.Recombinant mouse Cardiotrophin-1 produced in HEK293 cells is a polypeptide chain containing 202 amino acids. A fully biologically active molecule, rmCT-1 has a molecular mass of 22-27 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

The EC50 value of Mouse Cardiotrophin-1 determined by the dose-dependent proliferation of TF-1 cells was ≤ 1.25 ng/ml, corresponding to a specific activity of ≥ 0.8 x 10ˆ6 units/mg.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

22~27 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Mouse Cardiotrophin‑1 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Mouse Cardiotrophin‑1 should be stable up to 1 week at 4°C or up to 3 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

HEK 293

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

SQREGSLEDHQTDSSISFLPHLEAKIRQTHNLARLLTKYAEQLLEEYVQQQGEPFGLPGFSPPRLPLAGLSGPAPSHAGL PVSERLRQDAAALSVLPALLDAVRRRQAELNPRAPRLLRSLEDAARQVRALGAAVETVLAALGAAARGPGPEPVTVATLF TANSTAGIFSAKVLGFHVCGLYGEWVSRTEGDLGQLVPGGVA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Anti-Mouse H-2Kd/H-2Dd-FITC
MBS673685-01 0.5 mg

Mouse Anti-Mouse H-2Kd/H-2Dd-FITC

Sign In for Pricing
View Details
Mouse Anti-Mouse H-2Kd/H-2Dd-FITC
MBS673685-02 5x 0.5 mg

Mouse Anti-Mouse H-2Kd/H-2Dd-FITC

Sign In for Pricing
View Details
Recombinant Mouse TNFSF8/CD30 Ligand/CD153 Protein
MBS9149044-01 0.01 mg

Recombinant Mouse TNFSF8/CD30 Ligand/CD153 Protein

Sign In for Pricing
View Details
Recombinant Mouse TNFSF8/CD30 Ligand/CD153 Protein
MBS9149044-02 0.02 mg

Recombinant Mouse TNFSF8/CD30 Ligand/CD153 Protein

Sign In for Pricing
View Details
Recombinant Mouse TNFSF8/CD30 Ligand/CD153 Protein
MBS9149044-03 0.05 mg

Recombinant Mouse TNFSF8/CD30 Ligand/CD153 Protein

Sign In for Pricing
View Details
Recombinant Mouse TNFSF8/CD30 Ligand/CD153 Protein
MBS9149044-04 0.1 mg

Recombinant Mouse TNFSF8/CD30 Ligand/CD153 Protein

Sign In for Pricing
View Details