Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-9, Human

Interleukin 9, also known as IL9, is a cytokine (cell signalling molecule) belonging to the group of interleukins. The protein encoded by this gene is a cytokine produced by T-cells and specifically by CD4+ helper cells that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents apoptosis. It functions through the interleukin-9 receptor (IL9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. The gene encoding this cytokine has been identified as a candidate gene for asthma. Genetic studies on a mouse model of asthma demonstrated that this cytokine is a determining factor in the pathogenesis of bronchial hyperresponsiveness.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 < 1 ng/ml, measured in a cell proliferation assay using MO7e cells, corresponding to a specific activity of > 1x10ˆ6 units/mg.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

25-40 kDa, observed by non-reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human Interlerkin 9 (IL-9) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhIL-9 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEV LKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Sik1 shRNA (UAS) - Lentiviral mouse Sik1 shRNA (UAS) (100)
GTR15280590 1 Vial

Lentiviral mouse Sik1 shRNA (UAS) - Lentiviral mouse Sik1 shRNA (UAS) (100)

Sign In for Pricing
View Details
Rabbit Polyclonal C9orf72 Antibody [HRP]
NBP2-47146H 0.1 mL

Rabbit Polyclonal C9orf72 Antibody [HRP]

Sign In for Pricing
View Details
Anti-TDP43 TARDBP Monoclonal Antibody
M01001-1 100 µL

Anti-TDP43 TARDBP Monoclonal Antibody

Sign In for Pricing
View Details
CALB1 Antibody - N-terminal region
MBS3214658-01 0.1 mL

CALB1 Antibody - N-terminal region

Sign In for Pricing
View Details
CALB1 Antibody - N-terminal region
MBS3214658-02 5x 0.1 mL

CALB1 Antibody - N-terminal region

Sign In for Pricing
View Details
Mouse SOD1 (Superoxide Dismutase 1, Soluble) Microsample ELISA Kit
orb2999009-01 48 Tests

Mouse SOD1 (Superoxide Dismutase 1, Soluble) Microsample ELISA Kit

Sign In for Pricing
View Details