Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantEpigen, Human (CHO-expressed)

Epigen is an EGF-related polypeptide growth factor that signals through the ErbB receptor-1. It is produced in several tissues, including the testis, liver, heart and in certain tumor cells. Epigen is mitogenic for fibroblasts and epithelial cells. Human Epigen is initially synthesized as a glycosylated precursor protein, which is processed by proteolytic cleavage to produce a mature soluble sequence.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 1 μg/ml, measured in a proliferation assay using 3T3 cells.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

15~20 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Epigen remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Epigen should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

AVTVTPPITAQQGNWTVNKTEADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSY A

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Acetyl-S- (4-hydroxy-3-methyl-2-trans-buten-1-yl) -L-cysteine-d3 Dicyclohexylammonium Salt
CS-T-94373 1 Each

N-Acetyl-S- (4-hydroxy-3-methyl-2-trans-buten-1-yl) -L-cysteine-d3 Dicyclohexylammonium Salt

Sign In for Pricing
View Details
PCDHB6 (Protocadherin beta-6, PCDH-beta-6, PCDH-BETA6) (MaxLight 490)
MBS6202349-01 0.1 mL

PCDHB6 (Protocadherin beta-6, PCDH-beta-6, PCDH-BETA6) (MaxLight 490)

Sign In for Pricing
View Details
PCDHB6 (Protocadherin beta-6, PCDH-beta-6, PCDH-BETA6) (MaxLight 490)
MBS6202349-02 5x 0.1 mL

PCDHB6 (Protocadherin beta-6, PCDH-beta-6, PCDH-BETA6) (MaxLight 490)

Sign In for Pricing
View Details
SR1 (StemRegenin 1)
S2858-10mM/1mL 10 mM/1mL

SR1 (StemRegenin 1)

Sign In for Pricing
View Details
RPL14 Rabbit Polyclonal Antibody (Fluoro594)
orb3099694 100 µg

RPL14 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
Dyrk1a Rabbit Polyclonal Antibody (Biotin)
orb2117611 100 µL

Dyrk1a Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details