Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dyrk1a Rabbit Polyclonal Antibody (Biotin)

Dyrk1a Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Dyr, Mnb, mmb, Dyrk, Mnbh, Mp86, Gm10783, D16Ertd272, D16Ertd493, D16Ertd272e, D16Ertd493e, 2310043O08Rik

UniProt

Q63470

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SFHAAGLQMAAQMPHSHQYSDRRQPNISDQQVSALSYSDQIQQPLTNQVM

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

85kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_031916

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

hsa-miR-766-3p miRNA Antagomir
MNH03817 2x 5.0 nmol

hsa-miR-766-3p miRNA Antagomir

Sign In for Pricing
View Details
Human NADPH oxidase 4 ELISA Kit
MBS2883084-01 48 Well

Human NADPH oxidase 4 ELISA Kit

Sign In for Pricing
View Details
Human NADPH oxidase 4 ELISA Kit
MBS2883084-02 96 Well

Human NADPH oxidase 4 ELISA Kit

Sign In for Pricing
View Details
Human NADPH oxidase 4 ELISA Kit
MBS2883084-03 5x 96 Well

Human NADPH oxidase 4 ELISA Kit

Sign In for Pricing
View Details
Human NADPH oxidase 4 ELISA Kit
MBS2883084-04 10x 96 Well

Human NADPH oxidase 4 ELISA Kit

Sign In for Pricing
View Details
Fluor700 Rat IgM, kappa Isotype Control [RTK2118]
MBS2579308-01 20 Tests

Fluor700 Rat IgM, kappa Isotype Control [RTK2118]

Sign In for Pricing
View Details