Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantCINC-2α/CXCL3, Rat

Chemokine (C-X-C motif) ligand 3 (CXCL3) is a small cytokine belonging to the CXC chemokine family that is also known as MIP2β (macrophage inflammatory protein 2 beta), or DCIP1 (dendritic cell inflammatory protein1) in mouse, CINC-2 (cytokineinduced neutrophil attractant 2) in rat, or GROγ (growthregulated oncogene gamma) in human. CXCL3 controls migration and adhesion of monocytes and mediates its effects on target cells by interacting with the cell surface chemokine receptor CXCR2. It has been shown that CXCL3 regulates cerebellar granule neuron precursors toward the internal layers of the cerebellum during cerebellum morphogenesis. CXCL3 is a potential target for medulloblastoma therapy. CXCL3 is regulated transcriptionally by BTG2.Recombinant Rat CINC-2α/CXCL3 produced in CHO cells is a polypeptide chain containing 68 amino acids. A fully biologically active molecule, rrCINC-2α/CXCL3 has a molecular mass of 7.6 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 98% as analyzed by SDS-PAGE.

Bioactivity

The EC50 value of rat CINC‑2α/CXCL3 on Caˆ2+ mobilization assay in CHO-K1/Ga15/rCXCR2 cells (human G15 and ratCXCR2 stably expressed in CHO-K1 cells) is less than 100 ng/ml.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

7.6 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Rat CINC-2α/CXCL3 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, recombinant Rat CINC-2α/CXCL3 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

RELRCQCLKTLPRVDFENIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQAPRLQKIIQKLLKSDKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human papillomavirus type 16 Truncated L2 protein (L2), partial
CSB-EP6382HML-01 20 µg

Recombinant Human papillomavirus type 16 Truncated L2 protein (L2), partial

Sign In for Pricing
View Details
Recombinant Human papillomavirus type 16 Truncated L2 protein (L2), partial
CSB-EP6382HML-02 100 µg

Recombinant Human papillomavirus type 16 Truncated L2 protein (L2), partial

Sign In for Pricing
View Details
Recombinant Human papillomavirus type 16 Truncated L2 protein (L2), partial
CSB-EP6382HML-03 1 mg

Recombinant Human papillomavirus type 16 Truncated L2 protein (L2), partial

Sign In for Pricing
View Details
DDR1 Knockout NCI-H1703 Polyclonal Cells
ARG12553 1 Million

DDR1 Knockout NCI-H1703 Polyclonal Cells

Sign In for Pricing
View Details
Lentiviral human OR6C4 shRNA (UAS) - Lentiviral human OR6C4 shRNA (UAS, iRFP) plasmid
GTR15349891 1 Vial

Lentiviral human OR6C4 shRNA (UAS) - Lentiviral human OR6C4 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Phosphotyrosine
P4078-05 100 µg

Phosphotyrosine

Sign In for Pricing
View Details