Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human papillomavirus type 16 Truncated L2 protein (L2), partial

Product Specifications

Abbreviation

Recombinant Human papillomavirus type 16 L2 protein, partial

Gene Name

L2

UniProt

A0A023HHG4

Expression Region

11-78aa

Organism

Human papillomavirus type 16

Target Sequence

KRASATQLYKTCKQAGTCPPDIIPKVEGKTIADQILQYGSMGVFFGGLGIGTGSGTGGRTGYIPLGTR

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

13.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse RANκL (Receptor Activator of Nuclear Factor Kappa B Ligand) ELISA Kit
E-EL-M0644-01 24 Tests

Mouse RANκL (Receptor Activator of Nuclear Factor Kappa B Ligand) ELISA Kit

Sign In for Pricing
View Details
Mouse RANκL (Receptor Activator of Nuclear Factor Kappa B Ligand) ELISA Kit
E-EL-M0644-02 48 Tests

Mouse RANκL (Receptor Activator of Nuclear Factor Kappa B Ligand) ELISA Kit

Sign In for Pricing
View Details
Mouse RANκL (Receptor Activator of Nuclear Factor Kappa B Ligand) ELISA Kit
E-EL-M0644-03 96 Tests

Mouse RANκL (Receptor Activator of Nuclear Factor Kappa B Ligand) ELISA Kit

Sign In for Pricing
View Details
4930430F08Rik Mouse Gene Knockout Kit (CRISPR)
KN500362 1 Kit

4930430F08Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant APG5L Antibody
RC-4092-01 50 μL

Recombinant APG5L Antibody

Sign In for Pricing
View Details
Recombinant APG5L Antibody
RC-4092-02 100 µL

Recombinant APG5L Antibody

Sign In for Pricing
View Details