Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PNRC2 Rabbit pAb

Product Specifications

No additional specifications available.

More Discoveries

Explore Other Products

Browse additional items from our catalog

LUC7L2, CT (LUC7L2, Putative RNA-binding protein Luc7-like 2) (APC) discontinued
038009-APC 200 µL

LUC7L2, CT (LUC7L2, Putative RNA-binding protein Luc7-like 2) (APC) discontinued

Sign In for Pricing
View Details
Magic™ Membrane Protein Human ROBO2 (Roundabout guidance receptor 2) Full Length
MPC2972K Each

Magic™ Membrane Protein Human ROBO2 (Roundabout guidance receptor 2) Full Length

Sign In for Pricing
View Details
Polyclonal Antibody to NKx2.2
MBS668730-01 0.025 mg

Polyclonal Antibody to NKx2.2

Sign In for Pricing
View Details
Polyclonal Antibody to NKx2.2
MBS668730-02 0.1 mg

Polyclonal Antibody to NKx2.2

Sign In for Pricing
View Details
Polyclonal Antibody to NKx2.2
MBS668730-03 5x 0.1 mg

Polyclonal Antibody to NKx2.2

Sign In for Pricing
View Details
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
MBS5818163 Inquire

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Sign In for Pricing
View Details