Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Product Specifications

Gene Name

[VSGLNPSLWSIFGLQFILLWLVSGSRHYLW]

Storage Conditions

Powder: -20 degree C for 3 years | In solvent: -80 degree C for 1 year

Short Name

[VSGLNPSLWSIFGLQFILLWLVSGSRHYLW]

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tppp antibody - C-terminal region
MBS3203665-01 0.1 mL

Tppp antibody - C-terminal region

Sign In for Pricing
View Details
Tppp antibody - C-terminal region
MBS3203665-02 5x 0.1 mL

Tppp antibody - C-terminal region

Sign In for Pricing
View Details
Anti-CBR1 Antibody (R1P95)
RHD15602 100 μg

Anti-CBR1 Antibody (R1P95)

Sign In for Pricing
View Details
GENLISA Monkey Firefly Luciferase Immunoglobulin G (FL-IgG) ELISA
KLW1188 1x 96 Well

GENLISA Monkey Firefly Luciferase Immunoglobulin G (FL-IgG) ELISA

Sign In for Pricing
View Details
Goat Interleukin 9 (IL-9) ELISA Kit
YP-W75199-01 48 Tests

Goat Interleukin 9 (IL-9) ELISA Kit

Sign In for Pricing
View Details
Goat Interleukin 9 (IL-9) ELISA Kit
YP-W75199-02 96 Tests

Goat Interleukin 9 (IL-9) ELISA Kit

Sign In for Pricing
View Details