Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Product Specifications

Gene Name

[VSGLNPSLWSIFGLQFILLWLVSGSRHYLW]

Storage Conditions

Powder: -20 degree C for 3 years | In solvent: -80 degree C for 1 year

Short Name

[VSGLNPSLWSIFGLQFILLWLVSGSRHYLW]

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Antictrullinated Vimentin Antibody CVT.AB ELISA Kit
BG-MUS10020 1 Each

Mouse Antictrullinated Vimentin Antibody CVT.AB ELISA Kit

Sign In for Pricing
View Details
Recombinant Caenorhabditis elegans Leucine aminopeptidase 1 (lap-1)
MBS1028446-01 0.02 mg (E-Coli)

Recombinant Caenorhabditis elegans Leucine aminopeptidase 1 (lap-1)

Sign In for Pricing
View Details
Recombinant Caenorhabditis elegans Leucine aminopeptidase 1 (lap-1)
MBS1028446-02 0.02 mg (Yeast)

Recombinant Caenorhabditis elegans Leucine aminopeptidase 1 (lap-1)

Sign In for Pricing
View Details
Recombinant Caenorhabditis elegans Leucine aminopeptidase 1 (lap-1)
MBS1028446-03 0.1 mg (E-Coli)

Recombinant Caenorhabditis elegans Leucine aminopeptidase 1 (lap-1)

Sign In for Pricing
View Details
Recombinant Caenorhabditis elegans Leucine aminopeptidase 1 (lap-1)
MBS1028446-04 0.1 mg (Yeast)

Recombinant Caenorhabditis elegans Leucine aminopeptidase 1 (lap-1)

Sign In for Pricing
View Details
Recombinant Caenorhabditis elegans Leucine aminopeptidase 1 (lap-1)
MBS1028446-05 0.02 mg (Baculovirus)

Recombinant Caenorhabditis elegans Leucine aminopeptidase 1 (lap-1)

Sign In for Pricing
View Details