Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Product Specifications

Gene Name

[VSGLNPSLWSIFGLQFILLWLVSGSRHYLW]

Storage Conditions

Powder: -20 degree C for 3 years | In solvent: -80 degree C for 1 year

Short Name

[VSGLNPSLWSIFGLQFILLWLVSGSRHYLW]

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC anti-mouse CD8a
GT00270 500 µg

FITC anti-mouse CD8a

Sign In for Pricing
View Details
LMAN2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1220507 1.0 µg DNA

LMAN2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
CCL3 (C-C Motif Chemokine 3, G0/G1 Switch Regulatory Protein 19-1, Macrophage Inflammatory Protein 1-alpha, MIP-1-alpha, PAT 464.1, SIS-beta, Small-inducible Cytokine A3, Tonsillar Lymphocyte LD78 alpha Protein, G0S19-1, MIP1A, SCYA3) (HRP) discontinued
143655-HRP 100 µL

CCL3 (C-C Motif Chemokine 3, G0/G1 Switch Regulatory Protein 19-1, Macrophage Inflammatory Protein 1-alpha, MIP-1-alpha, PAT 464.1, SIS-beta, Small-inducible Cytokine A3, Tonsillar Lymphocyte LD78 alpha Protein, G0S19-1, MIP1A, SCYA3) (HRP) discontinued

Sign In for Pricing
View Details
RPL32P20 Adenovirus (Human)
41424051 1.0 mL

RPL32P20 Adenovirus (Human)

Sign In for Pricing
View Details
Rabbit Polyclonal RILP Antibody [PerCP]
NBP2-81991PCP 0.1 mL

Rabbit Polyclonal RILP Antibody [PerCP]

Sign In for Pricing
View Details
BC027231 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4689105 3x 1.0 µg

BC027231 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details