Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Product Specifications

Gene Name

[VSGLNPSLWSIFGLQFILLWLVSGSRHYLW]

Storage Conditions

Powder: -20 degree C for 3 years | In solvent: -80 degree C for 1 year

Short Name

[VSGLNPSLWSIFGLQFILLWLVSGSRHYLW]

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human 4-1BB Ligand/TNFSF9 MAb (Clone 2357A)
MAB22952-SP 25 µg

Human 4-1BB Ligand/TNFSF9 MAb (Clone 2357A)

Sign In for Pricing
View Details
CHRM3 Protein Vector (Human) (pPM-C-His)
PV050740 500 ng

CHRM3 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Recombinant Human MMP-9
MBS7614585-01 0.05 mg

Recombinant Human MMP-9

Sign In for Pricing
View Details
Recombinant Human MMP-9
MBS7614585-02 0.2 mg

Recombinant Human MMP-9

Sign In for Pricing
View Details
Recombinant Human MMP-9
MBS7614585-03 1 mg

Recombinant Human MMP-9

Sign In for Pricing
View Details
Recombinant Human MMP-9
MBS7614585-04 5x 1 mg

Recombinant Human MMP-9

Sign In for Pricing
View Details