Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Product Specifications

Gene Name

[VSGLNPSLWSIFGLQFILLWLVSGSRHYLW]

Storage Conditions

Powder: -20 degree C for 3 years | In solvent: -80 degree C for 1 year

Short Name

[VSGLNPSLWSIFGLQFILLWLVSGSRHYLW]

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Histone H2B type 1B [p Ser14] Antibody (RM238) [mFluor Violet 500 SE]
NBP3-26029MFV500 0.1 mL

Rabbit Monoclonal Histone H2B type 1B [p Ser14] Antibody (RM238) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
CD8 α&β Heterodimer Protein, Mouse, Recombinant (C-His-Flag)
E51P00432 100 µg

CD8 α&β Heterodimer Protein, Mouse, Recombinant (C-His-Flag)

Sign In for Pricing
View Details
Mouse Anti-Human Ig kappa chain - AF660
BS21929-01 100 µL

Mouse Anti-Human Ig kappa chain - AF660

Sign In for Pricing
View Details
Mouse Anti-Human Ig kappa chain - AF660
BS21929-02 500 µL

Mouse Anti-Human Ig kappa chain - AF660

Sign In for Pricing
View Details
Rabbit anti-Simian immunodeficiency virus agm.vervet (isolate AGM155)(SIV-agm.ver)(Simian immunodeficiency virus African green monkey vervet) TAT Polyclonal Antibody
MBS7158026 Inquire

Rabbit anti-Simian immunodeficiency virus agm.vervet (isolate AGM155)(SIV-agm.ver)(Simian immunodeficiency virus African green monkey vervet) TAT Polyclonal Antibody

Sign In for Pricing
View Details
Mouse UQCRH siRNA
abx939104-01 15 nmol

Mouse UQCRH siRNA

Sign In for Pricing
View Details