Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Product Specifications

Gene Name

[VSGLNPSLWSIFGLQFILLWLVSGSRHYLW]

Storage Conditions

Powder: -20 degree C for 3 years | In solvent: -80 degree C for 1 year

Short Name

[VSGLNPSLWSIFGLQFILLWLVSGSRHYLW]

More Discoveries

Explore Other Products

Browse additional items from our catalog

HNF 4 alpha (HNF4A) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8B8]
TA806576BM 100 µL

HNF 4 alpha (HNF4A) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8B8]

Sign In for Pricing
View Details
Recombinant Xenopus laevis Protein Wnt-11 (wnt11)
MBS1481522-01 0.02 mg (E-Coli)

Recombinant Xenopus laevis Protein Wnt-11 (wnt11)

Sign In for Pricing
View Details
Recombinant Xenopus laevis Protein Wnt-11 (wnt11)
MBS1481522-02 0.02 mg (Yeast)

Recombinant Xenopus laevis Protein Wnt-11 (wnt11)

Sign In for Pricing
View Details
Recombinant Xenopus laevis Protein Wnt-11 (wnt11)
MBS1481522-03 0.1 mg (E-Coli)

Recombinant Xenopus laevis Protein Wnt-11 (wnt11)

Sign In for Pricing
View Details
Recombinant Xenopus laevis Protein Wnt-11 (wnt11)
MBS1481522-04 0.1 mg (Yeast)

Recombinant Xenopus laevis Protein Wnt-11 (wnt11)

Sign In for Pricing
View Details
Recombinant Xenopus laevis Protein Wnt-11 (wnt11)
MBS1481522-05 0.02 mg (Baculovirus)

Recombinant Xenopus laevis Protein Wnt-11 (wnt11)

Sign In for Pricing
View Details