Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Product Specifications

Gene Name

[VSGLNPSLWSIFGLQFILLWLVSGSRHYLW]

Storage Conditions

Powder: -20 degree C for 3 years | In solvent: -80 degree C for 1 year

Short Name

[VSGLNPSLWSIFGLQFILLWLVSGSRHYLW]

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Separase (Ser1073) Rabbit pAb
E47R5304 100 µL

Phospho-Separase (Ser1073) Rabbit pAb

Sign In for Pricing
View Details
FADS1 Rabbit Polyclonal Antibody
TA369116 100 µL

FADS1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Elavl2 3'UTR Luciferase Stable Cell Line
TU203918 1.0 mL

Elavl2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana GATA transcription factor 21 (GATA21)
MBS1388204-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana GATA transcription factor 21 (GATA21)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana GATA transcription factor 21 (GATA21)
MBS1388204-02 0.02 mg (Yeast)

Recombinant Arabidopsis thaliana GATA transcription factor 21 (GATA21)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana GATA transcription factor 21 (GATA21)
MBS1388204-03 0.1 mg (E-Coli)

Recombinant Arabidopsis thaliana GATA transcription factor 21 (GATA21)

Sign In for Pricing
View Details