Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Product Specifications

Gene Name

[VSGLNPSLWSIFGLQFILLWLVSGSRHYLW]

Storage Conditions

Powder: -20 degree C for 3 years | In solvent: -80 degree C for 1 year

Short Name

[VSGLNPSLWSIFGLQFILLWLVSGSRHYLW]

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ccdc12 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4591706 1.0 µg DNA

Ccdc12 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
EGFR, Phosphorylated (T678) (Epidermal Growth Factor Receptor, ERBB, ERBB1, HER1, PIG61, MENA) (APC)
MBS6415222-01 0.1 mL

EGFR, Phosphorylated (T678) (Epidermal Growth Factor Receptor, ERBB, ERBB1, HER1, PIG61, MENA) (APC)

Sign In for Pricing
View Details
EGFR, Phosphorylated (T678) (Epidermal Growth Factor Receptor, ERBB, ERBB1, HER1, PIG61, MENA) (APC)
MBS6415222-02 5x 0.1 mL

EGFR, Phosphorylated (T678) (Epidermal Growth Factor Receptor, ERBB, ERBB1, HER1, PIG61, MENA) (APC)

Sign In for Pricing
View Details
MAGE-3 Antigen (271-279), Human
CCP1300-01 1 mg

MAGE-3 Antigen (271-279), Human

Sign In for Pricing
View Details
MAGE-3 Antigen (271-279), Human
CCP1300-02 5 mg

MAGE-3 Antigen (271-279), Human

Sign In for Pricing
View Details
MAGE-3 Antigen (271-279), Human
CCP1300-03 10 mg

MAGE-3 Antigen (271-279), Human

Sign In for Pricing
View Details