Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Product Specifications

Gene Name

[VSGLNPSLWSIFGLQFILLWLVSGSRHYLW]

Storage Conditions

Powder: -20 degree C for 3 years | In solvent: -80 degree C for 1 year

Short Name

[VSGLNPSLWSIFGLQFILLWLVSGSRHYLW]

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal SIX2 Antibody (3D7)
H00010736-M01 0.1 mg

Mouse Monoclonal SIX2 Antibody (3D7)

Sign In for Pricing
View Details
Human CD74 (HLA class II histocompatibility antigen gamma chain) ELISA Kit
RE3145H-01 48 Tests

Human CD74 (HLA class II histocompatibility antigen gamma chain) ELISA Kit

Sign In for Pricing
View Details
Human CD74 (HLA class II histocompatibility antigen gamma chain) ELISA Kit
RE3145H-02 96 Tests

Human CD74 (HLA class II histocompatibility antigen gamma chain) ELISA Kit

Sign In for Pricing
View Details
Human Lambda immunoglobulin light chain ELISA Kit
MBS7275713-01 48 Well

Human Lambda immunoglobulin light chain ELISA Kit

Sign In for Pricing
View Details
Human Lambda immunoglobulin light chain ELISA Kit
MBS7275713-02 96 Well

Human Lambda immunoglobulin light chain ELISA Kit

Sign In for Pricing
View Details
Human Lambda immunoglobulin light chain ELISA Kit
MBS7275713-03 5x 96 Well

Human Lambda immunoglobulin light chain ELISA Kit

Sign In for Pricing
View Details