Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Product Specifications

Gene Name

[VSGLNPSLWSIFGLQFILLWLVSGSRHYLW]

Storage Conditions

Powder: -20 degree C for 3 years | In solvent: -80 degree C for 1 year

Short Name

[VSGLNPSLWSIFGLQFILLWLVSGSRHYLW]

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Tlr11 activation kit by CRISPRa
GA214827 1 Kit

Mouse Tlr11 activation kit by CRISPRa

Sign In for Pricing
View Details
Gusb (NM_017015) Rat Tagged ORF Clone Lentiviral Particle
RR209794L4V 200 µL

Gusb (NM_017015) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PEX11B (Peroxisomal Membrane Protein 11B, Peroxin-11B, Peroxisomal Biogenesis Factor 11B, Protein PEX11 Homolog beta, PEX11-beta) (PE)
131166-PE 100 µL

PEX11B (Peroxisomal Membrane Protein 11B, Peroxin-11B, Peroxisomal Biogenesis Factor 11B, Protein PEX11 Homolog beta, PEX11-beta) (PE)

Sign In for Pricing
View Details
Tshr-set siRNA/shRNA/RNAi Lentivector (Mouse)
48562094 4x 500 ng

Tshr-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
PPP1R36 Protein Vector (Rat) (pPB-N-His)
PV295683 500 ng

PPP1R36 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Recombinant Mouse Semaphorin-4D (SEMA4D), C-Fc
AP2C853-01 1 mg

Recombinant Mouse Semaphorin-4D (SEMA4D), C-Fc

Sign In for Pricing
View Details