Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Product Specifications

Gene Name

[VSGLNPSLWSIFGLQFILLWLVSGSRHYLW]

Storage Conditions

Powder: -20 degree C for 3 years | In solvent: -80 degree C for 1 year

Short Name

[VSGLNPSLWSIFGLQFILLWLVSGSRHYLW]

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPECC1 Adenovirus (Human)
45259051 1.0 mL

SPECC1 Adenovirus (Human)

Sign In for Pricing
View Details
Mouse IL-1 RII ELISA Kit (Colorimetric)
NBP3-06740 1 Kit

Mouse IL-1 RII ELISA Kit (Colorimetric)

Sign In for Pricing
View Details
14-3-3 gamma Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-52004R-BF350 100 µL

14-3-3 gamma Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
GRIK5 Antibody
C44004-01 50 µL

GRIK5 Antibody

Sign In for Pricing
View Details
GRIK5 Antibody
C44004-02 100 µL

GRIK5 Antibody

Sign In for Pricing
View Details
KRT71 Antibody, HRP conjugated
A56369-50UG 50 µg

KRT71 Antibody, HRP conjugated

Sign In for Pricing
View Details