Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Product Specifications

Gene Name

[VSGLNPSLWSIFGLQFILLWLVSGSRHYLW]

Storage Conditions

Powder: -20 degree C for 3 years | In solvent: -80 degree C for 1 year

Short Name

[VSGLNPSLWSIFGLQFILLWLVSGSRHYLW]

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C10orf62 shRNA Plasmid
abx968204-01 150 µg

Human C10orf62 shRNA Plasmid

Sign In for Pricing
View Details
Human C10orf62 shRNA Plasmid
abx968204-02 300 µg

Human C10orf62 shRNA Plasmid

Sign In for Pricing
View Details
Pex10 (NM_001042407) Mouse Tagged Lenti ORF Clone
MR217970L3 10 µg

Pex10 (NM_001042407) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Tryptanthrin
sc-202844 1 mg

Tryptanthrin

Sign In for Pricing
View Details
Malignant T cell amplified sequence 1 (MCTS1) (3-14) rabbit polyclonal antibody, Aff - Purified
AP07498PU-N 50 µg

Malignant T cell amplified sequence 1 (MCTS1) (3-14) rabbit polyclonal antibody, Aff - Purified

Sign In for Pricing
View Details
RGD1305689 3'UTR Lenti-reporter-Luc Vector
66805086 1.0 µg

RGD1305689 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details