Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Product Specifications

Gene Name

[VSGLNPSLWSIFGLQFILLWLVSGSRHYLW]

Storage Conditions

Powder: -20 degree C for 3 years | In solvent: -80 degree C for 1 year

Short Name

[VSGLNPSLWSIFGLQFILLWLVSGSRHYLW]

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyanidin-3-O-arabinose chloride
292927-01 1 mg

Cyanidin-3-O-arabinose chloride

Sign In for Pricing
View Details
Cyanidin-3-O-arabinose chloride
292927-02 2 mg

Cyanidin-3-O-arabinose chloride

Sign In for Pricing
View Details
Cyanidin-3-O-arabinose chloride
292927-03 5 mg

Cyanidin-3-O-arabinose chloride

Sign In for Pricing
View Details
Semenogelin I antibody
70R-5491 50 ug

Semenogelin I antibody

Sign In for Pricing
View Details
ZNF689 3'UTR Luciferase Stable Cell Line
TU029368 1.0 mL

ZNF689 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Sheep Casein kinase II subunit alpha (CSNK2A1) ELISA Kit
MBS7245109-01 48 Well

Sheep Casein kinase II subunit alpha (CSNK2A1) ELISA Kit

Sign In for Pricing
View Details