Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Product Specifications

Gene Name

[VSGLNPSLWSIFGLQFILLWLVSGSRHYLW]

Storage Conditions

Powder: -20 degree C for 3 years | In solvent: -80 degree C for 1 year

Short Name

[VSGLNPSLWSIFGLQFILLWLVSGSRHYLW]

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human CAVIN3 shRNA (UAS) - Lentiviral human CAVIN3 shRNA (UAS, iRFP) plasmid
GTR15310291 1 Vial

Lentiviral human CAVIN3 shRNA (UAS) - Lentiviral human CAVIN3 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Mouse Monoclonal SPG7 Antibody (OTI1C1) [Alexa Fluor 750]
NBP2-74327AF750 0.1 mL

Mouse Monoclonal SPG7 Antibody (OTI1C1) [Alexa Fluor 750]

Sign In for Pricing
View Details
Bovine Transforming Growth Factor beta ELISA Kit
MBS006796-01 48 Well

Bovine Transforming Growth Factor beta ELISA Kit

Sign In for Pricing
View Details
Bovine Transforming Growth Factor beta ELISA Kit
MBS006796-02 96 Well

Bovine Transforming Growth Factor beta ELISA Kit

Sign In for Pricing
View Details
Bovine Transforming Growth Factor beta ELISA Kit
MBS006796-03 5x 96 Well

Bovine Transforming Growth Factor beta ELISA Kit

Sign In for Pricing
View Details
Bovine Transforming Growth Factor beta ELISA Kit
MBS006796-04 10x 96 Well

Bovine Transforming Growth Factor beta ELISA Kit

Sign In for Pricing
View Details