Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Product Specifications

Gene Name

[VSGLNPSLWSIFGLQFILLWLVSGSRHYLW]

Storage Conditions

Powder: -20 degree C for 3 years | In solvent: -80 degree C for 1 year

Short Name

[VSGLNPSLWSIFGLQFILLWLVSGSRHYLW]

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human LSAMP Protein
MBS8249407-01 0.01 mg

Recombinant Human LSAMP Protein

Sign In for Pricing
View Details
Recombinant Human LSAMP Protein
MBS8249407-02 0.05 mg

Recombinant Human LSAMP Protein

Sign In for Pricing
View Details
Recombinant Human LSAMP Protein
MBS8249407-03 0.5 mg

Recombinant Human LSAMP Protein

Sign In for Pricing
View Details
Recombinant Human LSAMP Protein
MBS8249407-04 5x 0.5 mg

Recombinant Human LSAMP Protein

Sign In for Pricing
View Details
Olfr799 Mouse shRNA Plasmid (Locus ID 258929)
TL507967 1 Kit

Olfr799 Mouse shRNA Plasmid (Locus ID 258929)

Sign In for Pricing
View Details
Mouse Monoclonal PDX-1/IPF1 Antibody (267712) [DyLight 680]
FAB2419Y 0.1 mL

Mouse Monoclonal PDX-1/IPF1 Antibody (267712) [DyLight 680]

Sign In for Pricing
View Details