Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Product Specifications

Gene Name

[VSGLNPSLWSIFGLQFILLWLVSGSRHYLW]

Storage Conditions

Powder: -20 degree C for 3 years | In solvent: -80 degree C for 1 year

Short Name

[VSGLNPSLWSIFGLQFILLWLVSGSRHYLW]

More Discoveries

Explore Other Products

Browse additional items from our catalog

NLRC5 Knockout caski Polyclonal Cells
ARG9825 1 Million

NLRC5 Knockout caski Polyclonal Cells

Sign In for Pricing
View Details
ALKBH4 (NM_017621) Human 3' UTR Clone
SC212885 10 µg

ALKBH4 (NM_017621) Human 3' UTR Clone

Sign In for Pricing
View Details
Sunlong Medical™ Rat IL-1β High Sensitivity ELISA Kit
HS-EL0039Ra-01 96 Tests

Sunlong Medical™ Rat IL-1β High Sensitivity ELISA Kit

Sign In for Pricing
View Details
Sunlong Medical™ Rat IL-1β High Sensitivity ELISA Kit
HS-EL0039Ra-02 48 Tests

Sunlong Medical™ Rat IL-1β High Sensitivity ELISA Kit

Sign In for Pricing
View Details
Recombinant Vibrio vulnificus ATP synthase subunit b (atpF), partial
MBS1380929-01 0.5 mg (E-Coli)

Recombinant Vibrio vulnificus ATP synthase subunit b (atpF), partial

Sign In for Pricing
View Details
Recombinant Vibrio vulnificus ATP synthase subunit b (atpF), partial
MBS1380929-02 0.05 mg (Baculovirus)

Recombinant Vibrio vulnificus ATP synthase subunit b (atpF), partial

Sign In for Pricing
View Details