Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Product Specifications

Gene Name

[VSGLNPSLWSIFGLQFILLWLVSGSRHYLW]

Storage Conditions

Powder: -20 degree C for 3 years | In solvent: -80 degree C for 1 year

Short Name

[VSGLNPSLWSIFGLQFILLWLVSGSRHYLW]

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gabra4 ORF Vector (Rat) (pORF)
ORF067354 1.0 µg DNA

Gabra4 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
KTELC1 Antibody
C50452-01 50 μL

KTELC1 Antibody

Sign In for Pricing
View Details
KTELC1 Antibody
C50452-02 100 µL

KTELC1 Antibody

Sign In for Pricing
View Details
Chicken A Disintegrin And Metalloprotease 8 (ADAM8) ELISA Kit
EIA05199Ch 1 Kit

Chicken A Disintegrin And Metalloprotease 8 (ADAM8) ELISA Kit

Sign In for Pricing
View Details
Rat Capza2 ELISA Kit
ELI-10890r 96 Tests

Rat Capza2 ELISA Kit

Sign In for Pricing
View Details
DNA-directed RNA polymerase I subunit RPA2 (POLR1B) Mouse ELISA Kit
C9598 96 Tests

DNA-directed RNA polymerase I subunit RPA2 (POLR1B) Mouse ELISA Kit

Sign In for Pricing
View Details