Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Product Specifications

Gene Name

[VSGLNPSLWSIFGLQFILLWLVSGSRHYLW]

Storage Conditions

Powder: -20 degree C for 3 years | In solvent: -80 degree C for 1 year

Short Name

[VSGLNPSLWSIFGLQFILLWLVSGSRHYLW]

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRC36 Rabbit Polyclonal Antibody
TA359082 100 µL

LRRC36 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CPLX1 (NM_006651) Human Over-expression Lysate
LS010815-100ug 100 µg

CPLX1 (NM_006651) Human Over-expression Lysate

Sign In for Pricing
View Details
Rat CD93 Antibody Pair Set
ABPR-ZB298 5 plates, 15 plates

Rat CD93 Antibody Pair Set

Sign In for Pricing
View Details
GENLISA™ Hamster Colony-Stimulating Factor (CSF) ELISA
KLH0058 1x 96 Well

GENLISA™ Hamster Colony-Stimulating Factor (CSF) ELISA

Sign In for Pricing
View Details
Human Beta-Lipotropic Hormone (bLPH) ELISA Kit
EKN43819 96 Tests

Human Beta-Lipotropic Hormone (bLPH) ELISA Kit

Sign In for Pricing
View Details
IL6 (Interleukin 6 (Interferon, beta 2), BSF2, HGF, HSF, IFNB2, IL-6) (MaxLight 650)
247606-ML650 100 µL

IL6 (Interleukin 6 (Interferon, beta 2), BSF2, HGF, HSF, IFNB2, IL-6) (MaxLight 650)

Sign In for Pricing
View Details