Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Product Specifications

Gene Name

[VSGLNPSLWSIFGLQFILLWLVSGSRHYLW]

Storage Conditions

Powder: -20 degree C for 3 years | In solvent: -80 degree C for 1 year

Short Name

[VSGLNPSLWSIFGLQFILLWLVSGSRHYLW]

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kcnb2 Mouse qPCR Primer Pair (NM_001098528)
MP219469 200 Reactions

Kcnb2 Mouse qPCR Primer Pair (NM_001098528)

Sign In for Pricing
View Details
Rabbit anti-Caenorhabditis elegans ZK177.2 Polyclonal Antibody
MBS7170221 Inquire

Rabbit anti-Caenorhabditis elegans ZK177.2 Polyclonal Antibody

Sign In for Pricing
View Details
1-Hydroxybenzotriazole, Polystyrene Supported
409858-01 1 g

1-Hydroxybenzotriazole, Polystyrene Supported

Sign In for Pricing
View Details
1-Hydroxybenzotriazole, Polystyrene Supported
409858-02 2.5 g

1-Hydroxybenzotriazole, Polystyrene Supported

Sign In for Pricing
View Details
Arid4b sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6290806 1.0 µg DNA

Arid4b sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
SNX33 (NM_153271) Human Recombinant Protein
TP305879M 100 µg

SNX33 (NM_153271) Human Recombinant Protein

Sign In for Pricing
View Details