Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTCF, Human

CTCF protein is a chromatin-binding factor that plays multiple roles in transcriptional regulation and epigenetic control. It binds to DNA at specific sites and acts as a transcriptional repressor by binding to chromatin insulators to prevent undesirable interactions between promoters and neighboring enhancers or silencers. CTCF Protein, Human is the recombinant human-derived CTCF protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

CTCF Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ctcf-protein-human.html

Purity

95.00

Smiles

MEGDAVEAIVEESETFIKGKERKTYQRRREGGQEEDACHLPQNQTDGGEVVQDVNSSVQMVMMEQLDPTLLQMKTEVMEGTVAPEAEAAVDDTQIITLQVVNMEEQPINIGELQLVQVPVPVTVPVATTSVEELQGAYENEVSKEGLAESEPMI

Molecular Formula

10664 (Gene_ID) P49711-1 (M1-I154) (Accession)

Molecular Weight

Approximately 38 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(E/Z) -THZ1 (dihydrochloride)
HY-80013B-01 1 mg

(E/Z) -THZ1 (dihydrochloride)

Sign In for Pricing
View Details
(E/Z) -THZ1 (dihydrochloride)
HY-80013B-02 5 mg

(E/Z) -THZ1 (dihydrochloride)

Sign In for Pricing
View Details
(E/Z) -THZ1 (dihydrochloride)
HY-80013B-03 10 mg

(E/Z) -THZ1 (dihydrochloride)

Sign In for Pricing
View Details
(E/Z) -THZ1 (dihydrochloride)
HY-80013B-04 25 mg

(E/Z) -THZ1 (dihydrochloride)

Sign In for Pricing
View Details
(E/Z) -THZ1 (dihydrochloride)
HY-80013B-05 50 mg

(E/Z) -THZ1 (dihydrochloride)

Sign In for Pricing
View Details
Lentiviral human KBTBD13 shRNA (UAS) - Lentiviral human KBTBD13 shRNA (UAS, iRFP) (100)
GTR15344598 1 Vial

Lentiviral human KBTBD13 shRNA (UAS) - Lentiviral human KBTBD13 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details