Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD1D, Human (His-SUMO)

The CD1D protein, a key antigen-presenting molecule, binds self and non-self glycolipids, presenting them to T-cell receptors on natural killer T-cells. Partnering with B2M, it centrally orchestrates immune responses, and its interactions with MHC II emphasize its significance in the intricate network of immune system regulation. CD1D Protein, Human (His-SUMO) is the recombinant human-derived CD1D, expressed by E. coli, with N-6*His, N-SUMO labeled tag. The total length of CD1D Protein, Human (His-SUMO) is 282 a.a..

Product Specifications

Product Name Alternative

CD1D Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/cd1d-protein-human-his-sumo.html

Smiles

EVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWGGSYTS

Molecular Formula

912 (Gene_ID) P15813 (E20-S301) (Accession)

Molecular Weight

Approximately 47.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3mC Recombinant Rabbit Monoclonal Antibody [PSH03-22]
HA721958 100 µL

3mC Recombinant Rabbit Monoclonal Antibody [PSH03-22]

Sign In for Pricing
View Details
Mouse Gjb2 activation kit by CRISPRa
GA201619 1 Kit

Mouse Gjb2 activation kit by CRISPRa

Sign In for Pricing
View Details
TRAcP (Tartarate Resistant Acid Phosphatase) (ACP5/1070), CF568 conjugate, 0.1mg/mL
BNC681070-500 1x 500 µL

TRAcP (Tartarate Resistant Acid Phosphatase) (ACP5/1070), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (EGP40/837), CF405S conjugate, 0.1mg/mL
BNC040837-500 1x 500 µL

Ep-CAM / CD326 (EGP40/837), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human RBAK-RBAKDN activation kit by CRISPRa
GA119385 1 Kit

Human RBAK-RBAKDN activation kit by CRISPRa

Sign In for Pricing
View Details
Human RNF89 (TRIM6) activation kit by CRISPRa
GA114653 1 Kit

Human RNF89 (TRIM6) activation kit by CRISPRa

Sign In for Pricing
View Details