Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INSL4, Human (HEK293, His)

The INSL4 protein plays a potentially critical role in the regulation of trophoblast development and bone formation. The specific mechanism of trophoblast development deserves further study. INSL4 Protein, Human (HEK293, His) is the recombinant human-derived INSL4 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

INSL4 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/insl4-protein-human-hek-293-his.html

Purity

90.0

Smiles

AELRGCGPRFGKHLLSYCPMPEKTFTTTPGGWLLESGRPKEMVSTSNNKDGQALGTTSEFIPNLSPELKKPLSEGQPSLKKIILSRKKRSGRHRFDPFCCEVICDDGTSVKLCT

Molecular Formula

3641 (Gene_ID) Q14641 (A26-T139) (Accession)

Molecular Weight

Approximately 9.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Cox4i1 / Cytochrome c oxidase subunit 4 isoform 1, mitochondrial Recombinant Protein
R10129r 1 Each

Rat Cox4i1 / Cytochrome c oxidase subunit 4 isoform 1, mitochondrial Recombinant Protein

Sign In for Pricing
View Details
Pump Tube LMT-55 3 tabs: green-green
1210196 12 PK

Pump Tube LMT-55 3 tabs: green-green

Sign In for Pricing
View Details
CD6 / TP120 Recombinant Protein
11-241 0.1 mg

CD6 / TP120 Recombinant Protein

Sign In for Pricing
View Details
Anti-FZD3 Antibody Picoband® Fluoro647 Conjugated
A04680-1-Fluoro647 100 µg/Vial

Anti-FZD3 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
Human Kelch repeat and BTB domain-containing protein 11 (KBTBD11) ELISA Kit
abx529433 96 Tests

Human Kelch repeat and BTB domain-containing protein 11 (KBTBD11) ELISA Kit

Sign In for Pricing
View Details
Proser2 Mouse shRNA Plasmid (Locus ID 227545)
TR516991 1 Kit

Proser2 Mouse shRNA Plasmid (Locus ID 227545)

Sign In for Pricing
View Details