Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOC2, Human (His, solution)

Apolipoprotein C-II Protein, Human (His) is expressed in E. coli with a His tag at the N-terminus. Apolipoprotein C-II Protein, Human (His) has a pharmacological application for the treatment of patients with genetic hypertriglyceridemia caused by ApoC-II otein C-II Protein, Human (His) is expressed in E. coli with 6*His tag at the C-terminus. Apolipoprotein C-II Protein, Human (His) has a pharmacological application for the treatment of patients with genetic hypertriglyceridemia caused by ApoC-II deficiency[1].

Product Specifications

Product Name Alternative

APOC2 Protein, Human (His, solution), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apolipoprotein-c-ii-protein-human-his.html

Purity

98.0

Smiles

TQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEEHHHHHH

Molecular Formula

344 (Gene_ID) P02655 (T23-E101) (Accession)

Molecular Weight

Approximately 14 kDa

References & Citations

Escherichia coli

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Collagen Type I (MaxLight 650)
MBS6220194-01 0.1 mL

Collagen Type I (MaxLight 650)

Sign In for Pricing
View Details
Collagen Type I (MaxLight 650)
MBS6220194-02 5x 0.1 mL

Collagen Type I (MaxLight 650)

Sign In for Pricing
View Details
13 (Z),16 (Z) -Docosadienyl acetate
HY-165888 1 Each

13 (Z),16 (Z) -Docosadienyl acetate

Sign In for Pricing
View Details
Porcine Potassium Channel Subfamily K Member 3 (KCNK3) ELISA Kit
MBS9371210-01 48 Well

Porcine Potassium Channel Subfamily K Member 3 (KCNK3) ELISA Kit

Sign In for Pricing
View Details
Porcine Potassium Channel Subfamily K Member 3 (KCNK3) ELISA Kit
MBS9371210-02 96 Well

Porcine Potassium Channel Subfamily K Member 3 (KCNK3) ELISA Kit

Sign In for Pricing
View Details
Porcine Potassium Channel Subfamily K Member 3 (KCNK3) ELISA Kit
MBS9371210-03 5x 96 Well

Porcine Potassium Channel Subfamily K Member 3 (KCNK3) ELISA Kit

Sign In for Pricing
View Details