Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MECR, Human (HEK293, His)

MECR Protein, Human (HEK293, His) is the recombinant human-derived MECR protein, expressed by HEK293, with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MECR Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mecr-protein-human-hek-293-his.html

Purity

95.0

Smiles

PAKVVELKNLELAAVRGSDVRVKMLAAPINPSDINMIQGNYGFLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPANAGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILTM

Molecular Formula

51102 (Gene_ID) AAH01419.1 (P54-M373) (Accession)

Molecular Weight

Approximately 39.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human La-related protein 7, LARP7 ELISA KIT
ELI-23331h 96 Tests

Human La-related protein 7, LARP7 ELISA KIT

Sign In for Pricing
View Details
COL8A2 Recombinant Protein (Human)
RP038221 100 µg

COL8A2 Recombinant Protein (Human)

Sign In for Pricing
View Details
FGF21 Knockout Cell Lysate
ABC-KC0681 100 µg

FGF21 Knockout Cell Lysate

Sign In for Pricing
View Details
NKX2-5 Antibody
MBS2522630-01 0.06 mL

NKX2-5 Antibody

Sign In for Pricing
View Details
NKX2-5 Antibody
MBS2522630-02 0.12 mL

NKX2-5 Antibody

Sign In for Pricing
View Details
NKX2-5 Antibody
MBS2522630-03 0.2 mL

NKX2-5 Antibody

Sign In for Pricing
View Details