MECR, Human (HEK293, His)
MECR Protein, Human (HEK293, His) is the recombinant human-derived MECR protein, expressed by HEK293, with C-6*His labeled tag.
Product Specifications
Product Name Alternative
MECR Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/mecr-protein-human-hek-293-his.html
Purity
95.0
Smiles
PAKVVELKNLELAAVRGSDVRVKMLAAPINPSDINMIQGNYGFLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPANAGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILTM
Molecular Formula
51102 (Gene_ID) AAH01419.1 (P54-M373) (Accession)
Molecular Weight
Approximately 39.0 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
I7661-32B-APC 100 µL
Integrin alpha2, beta1 (Collagen Receptor, VLA2) (Azide Free) (APC)
Sign In for Pricing
View Details 
K0499408 1.0 µg DNA
CPEB4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
Sign In for Pricing
View Details 
MBS6321066-01 0.2 mL
MLF1IP, CT (MLF1IP, CENPU, ICEN24, KLIP1, PBIP1, Centromere protein U, Interphase centromere complex protein 24, KSHV latent nuclear antigen-interacting protein 1, MLF1-interacting protein, Polo-box-interacting protein 1, centromere protein of 50kD) (Biot
Sign In for Pricing
View Details MBS6321066-02 5x 0.2 mL
MLF1IP, CT (MLF1IP, CENPU, ICEN24, KLIP1, PBIP1, Centromere protein U, Interphase centromere complex protein 24, KSHV latent nuclear antigen-interacting protein 1, MLF1-interacting protein, Polo-box-interacting protein 1, centromere protein of 50kD) (Biot
Sign In for Pricing
View Details K7125206 1.0 µg DNA
Arf4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
Sign In for Pricing
View Details T9160-21-FITC 100 µL
Tumor Necrosis Factor alpha (TNF) (FITC) discontinued
Sign In for Pricing
View Details