MECR, Human (HEK293, His)
MECR Protein, Human (HEK293, His) is the recombinant human-derived MECR protein, expressed by HEK293, with C-6*His labeled tag.
Product Specifications
Product Name Alternative
MECR Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/mecr-protein-human-hek-293-his.html
Purity
95.0
Smiles
PAKVVELKNLELAAVRGSDVRVKMLAAPINPSDINMIQGNYGFLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPANAGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILTM
Molecular Formula
51102 (Gene_ID) AAH01419.1 (P54-M373) (Accession)
Molecular Weight
Approximately 39.0 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
abx507377 96 Tests
Rat Caseinolytic Peptidase B Protein Homolog (CLPB) ELISA Kit
Sign In for Pricing
View Details 
RC216212L4 10 µg
PPP1A (PPP1CA) (NM_206873) Human Tagged Lenti ORF Clone
Sign In for Pricing
View Details MBS9903598 Inquire
Donkey Segment Polarity Protein Dishevelled Homolog DVL-2 (DVL2) ELISA Kit
Sign In for Pricing
View Details MBS9922911-01 48 Well
Canine Zinc Finger and BTB Domain-Containing Protein 42 (ZBTB42) ELISA Kit
Sign In for Pricing
View Details MBS9922911-02 96 Well
Canine Zinc Finger and BTB Domain-Containing Protein 42 (ZBTB42) ELISA Kit
Sign In for Pricing
View Details MBS9922911-03 5x 96 Well
Canine Zinc Finger and BTB Domain-Containing Protein 42 (ZBTB42) ELISA Kit
Sign In for Pricing
View Details