Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MECR, Human (HEK293, His)

MECR Protein, Human (HEK293, His) is the recombinant human-derived MECR protein, expressed by HEK293, with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MECR Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mecr-protein-human-hek-293-his.html

Purity

95.0

Smiles

PAKVVELKNLELAAVRGSDVRVKMLAAPINPSDINMIQGNYGFLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPANAGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILTM

Molecular Formula

51102 (Gene_ID) AAH01419.1 (P54-M373) (Accession)

Molecular Weight

Approximately 39.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal UCH-L1/PGP9.5 Antibody (rUCHL1/775) [Allophycocyanin]
NBP2-75775APC 0.1 mL

Mouse Monoclonal UCH-L1/PGP9.5 Antibody (rUCHL1/775) [Allophycocyanin]

Sign In for Pricing
View Details
Rabbit Polyclonal ACADSB Antibody [DyLight 680]
NBP2-99387FR 0.1 mL

Rabbit Polyclonal ACADSB Antibody [DyLight 680]

Sign In for Pricing
View Details
Mouse Monoclonal Myoneurin Antibody (OTI3B9) [PE/Atto594]
NBP2-72864PEATT594 0.1 mL

Mouse Monoclonal Myoneurin Antibody (OTI3B9) [PE/Atto594]

Sign In for Pricing
View Details
Tspo2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4076206 1.0 µg DNA

Tspo2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
SHP-2
PA1114-M 100μg

SHP-2

Sign In for Pricing
View Details
Cse1l (NM_023565) Mouse Tagged ORF Clone
MR215858 10 µg

Cse1l (NM_023565) Mouse Tagged ORF Clone

Sign In for Pricing
View Details