Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MECR, Human (HEK293, His)

MECR Protein, Human (HEK293, His) is the recombinant human-derived MECR protein, expressed by HEK293, with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MECR Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mecr-protein-human-hek-293-his.html

Purity

95.0

Smiles

PAKVVELKNLELAAVRGSDVRVKMLAAPINPSDINMIQGNYGFLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPANAGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILTM

Molecular Formula

51102 (Gene_ID) AAH01419.1 (P54-M373) (Accession)

Molecular Weight

Approximately 39.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human GUCD1 sgRNA gene knockout kit - Lentiviral human GUCD1 sgRNA gene knockout kit (plasmid)
GTR15399254 1 Vial

Lentiviral human GUCD1 sgRNA gene knockout kit - Lentiviral human GUCD1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
ARFGAP1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H4]
TA502594AM 100 µL

ARFGAP1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H4]

Sign In for Pricing
View Details
Rat LXRβ (liver X Receptor Beta) ELISA Kit
RE3508R-01 48 Tests

Rat LXRβ (liver X Receptor Beta) ELISA Kit

Sign In for Pricing
View Details
Rat LXRβ (liver X Receptor Beta) ELISA Kit
RE3508R-02 96 Tests

Rat LXRβ (liver X Receptor Beta) ELISA Kit

Sign In for Pricing
View Details
Anti-OSBPL11 Antibody
CTA2365-01 30 µL

Anti-OSBPL11 Antibody

Sign In for Pricing
View Details
Anti-OSBPL11 Antibody
CTA2365-02 50 μL

Anti-OSBPL11 Antibody

Sign In for Pricing
View Details