Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MECR, Human (HEK293, His)

MECR Protein, Human (HEK293, His) is the recombinant human-derived MECR protein, expressed by HEK293, with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MECR Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mecr-protein-human-hek-293-his.html

Purity

95.0

Smiles

PAKVVELKNLELAAVRGSDVRVKMLAAPINPSDINMIQGNYGFLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPANAGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILTM

Molecular Formula

51102 (Gene_ID) AAH01419.1 (P54-M373) (Accession)

Molecular Weight

Approximately 39.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NTRK2 (TRKB, BDNF/NT-3 Growth Factors Receptor, GP145-TrkB, Neurotrophic Tyrosine Kinase Receptor Type 2, TrkB Tyrosine Kinase, Tropomyosin-related Kinase B) (MaxLight 490)
MBS6202206-01 0.1 mL

NTRK2 (TRKB, BDNF/NT-3 Growth Factors Receptor, GP145-TrkB, Neurotrophic Tyrosine Kinase Receptor Type 2, TrkB Tyrosine Kinase, Tropomyosin-related Kinase B) (MaxLight 490)

Sign In for Pricing
View Details
NTRK2 (TRKB, BDNF/NT-3 Growth Factors Receptor, GP145-TrkB, Neurotrophic Tyrosine Kinase Receptor Type 2, TrkB Tyrosine Kinase, Tropomyosin-related Kinase B) (MaxLight 490)
MBS6202206-02 5x 0.1 mL

NTRK2 (TRKB, BDNF/NT-3 Growth Factors Receptor, GP145-TrkB, Neurotrophic Tyrosine Kinase Receptor Type 2, TrkB Tyrosine Kinase, Tropomyosin-related Kinase B) (MaxLight 490)

Sign In for Pricing
View Details
Rabbit Polyclonal LRRC16A Antibody
NBP3-30479 100 µg

Rabbit Polyclonal LRRC16A Antibody

Sign In for Pricing
View Details
PTEN (Phospho S380) (15B1) Rabbit Monoclonal Antibody
E28G2114 100 µL

PTEN (Phospho S380) (15B1) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
AS250
398215-01 50 µL

AS250

Sign In for Pricing
View Details
AS250
398215-02 100 µL

AS250

Sign In for Pricing
View Details