Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MECR, Human (HEK293, His)

MECR Protein, Human (HEK293, His) is the recombinant human-derived MECR protein, expressed by HEK293, with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MECR Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mecr-protein-human-hek-293-his.html

Purity

95.0

Smiles

PAKVVELKNLELAAVRGSDVRVKMLAAPINPSDINMIQGNYGFLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPANAGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILTM

Molecular Formula

51102 (Gene_ID) AAH01419.1 (P54-M373) (Accession)

Molecular Weight

Approximately 39.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tenascin-C (TN-C) Rat ELISA Kit
H5072 96 Tests

Tenascin-C (TN-C) Rat ELISA Kit

Sign In for Pricing
View Details
TACC3 (phospho-Ser558) rabbit pAb
RA30260-01 50 µL

TACC3 (phospho-Ser558) rabbit pAb

Sign In for Pricing
View Details
TACC3 (phospho-Ser558) rabbit pAb
RA30260-02 100 µL

TACC3 (phospho-Ser558) rabbit pAb

Sign In for Pricing
View Details
Lentiviral mouse Kif5a shRNA (UAS) - Lentiviral mouse Kif5a shRNA (UAS, GFP) (100)
GTR15170913 1 Vial

Lentiviral mouse Kif5a shRNA (UAS) - Lentiviral mouse Kif5a shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
BHLHA15 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0182605 3x 1.0 µg

BHLHA15 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
AMN1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0081708 1.0 µg DNA

AMN1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details