Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MECR, Human (HEK293, His)

MECR Protein, Human (HEK293, His) is the recombinant human-derived MECR protein, expressed by HEK293, with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MECR Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mecr-protein-human-hek-293-his.html

Purity

95.0

Smiles

PAKVVELKNLELAAVRGSDVRVKMLAAPINPSDINMIQGNYGFLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPANAGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILTM

Molecular Formula

51102 (Gene_ID) AAH01419.1 (P54-M373) (Accession)

Molecular Weight

Approximately 39.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

AC1903 10mM * 1mL in DMSO
A22296-10mM-D 10 mM x 1mL in DMSO

AC1903 10mM * 1mL in DMSO

Sign In for Pricing
View Details
Opn1mw (OPN1MW2) (NM_001048181) Human Over-expression Lysate
LH05241V 100 µg

Opn1mw (OPN1MW2) (NM_001048181) Human Over-expression Lysate

Sign In for Pricing
View Details
4-Amino-3-hydroxynaphthalene-1-sulfonic acid
HY-W013430 1 g

4-Amino-3-hydroxynaphthalene-1-sulfonic acid

Sign In for Pricing
View Details
Human PTD016 (RNFT1) (NM_016125) AAV Particle
RC223569A1V 250 µL

Human PTD016 (RNFT1) (NM_016125) AAV Particle

Sign In for Pricing
View Details
Anti-CD23 Mouse mAb
GB14032-50 50 μL

Anti-CD23 Mouse mAb

Sign In for Pricing
View Details
HOXD3 Recombinant Protein Antigen
NBP2-56817PEP 100 µL

HOXD3 Recombinant Protein Antigen

Sign In for Pricing
View Details