Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MECR, Human (HEK293, His)

MECR Protein, Human (HEK293, His) is the recombinant human-derived MECR protein, expressed by HEK293, with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MECR Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mecr-protein-human-hek-293-his.html

Purity

95.0

Smiles

PAKVVELKNLELAAVRGSDVRVKMLAAPINPSDINMIQGNYGFLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPANAGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILTM

Molecular Formula

51102 (Gene_ID) AAH01419.1 (P54-M373) (Accession)

Molecular Weight

Approximately 39.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HPRT1 Recombinant Antibody, Cy5.5 Conjugated
bsm-61635R-Cy5.5 100 µL

HPRT1 Recombinant Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Cholic acid (sodium monohydrate)
HY-W355001 1 Each

Cholic acid (sodium monohydrate)

Sign In for Pricing
View Details
Recombinant Human AP-3 complex subunit beta-1/AP3B1
32-10093-500 500 µg

Recombinant Human AP-3 complex subunit beta-1/AP3B1

Sign In for Pricing
View Details
Recombinant Pig Vasopressin V2 receptor Protein, His-SUMO, E.coli-200ug
QP5701-ec-200ug 200ug

Recombinant Pig Vasopressin V2 receptor Protein, His-SUMO, E.coli-200ug

Sign In for Pricing
View Details
Recombinant Human TMEFF2 Protein, N-His
E55P3193 50 µg

Recombinant Human TMEFF2 Protein, N-His

Sign In for Pricing
View Details
Cardiac Troponin C Antibody (HRP)
KH-2680-01 50 μL

Cardiac Troponin C Antibody (HRP)

Sign In for Pricing
View Details