Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MECR, Human (HEK293, His)

MECR Protein, Human (HEK293, His) is the recombinant human-derived MECR protein, expressed by HEK293, with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MECR Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mecr-protein-human-hek-293-his.html

Purity

95.0

Smiles

PAKVVELKNLELAAVRGSDVRVKMLAAPINPSDINMIQGNYGFLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPANAGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILTM

Molecular Formula

51102 (Gene_ID) AAH01419.1 (P54-M373) (Accession)

Molecular Weight

Approximately 39.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

96 x 0.2 ml Plate
B50501 25 Plates/Box

96 x 0.2 ml Plate

Sign In for Pricing
View Details
Cbll1 ORF Vector (Rat) (pORF)
ORF064430 1.0 µg DNA

Cbll1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
alpha 2 Antiplasmin antibody
MBS833574-01 5 mg

alpha 2 Antiplasmin antibody

Sign In for Pricing
View Details
alpha 2 Antiplasmin antibody
MBS833574-02 5x 5 mg

alpha 2 Antiplasmin antibody

Sign In for Pricing
View Details
ARPE-19-Cas9 Cell Line
RG-110 1x 10^6

ARPE-19-Cas9 Cell Line

Sign In for Pricing
View Details
Rabbit Anti-Human RPAP3 pAb
PA8872-01 50 μL

Rabbit Anti-Human RPAP3 pAb

Sign In for Pricing
View Details