Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Avidin (AVD)

Product Specifications

Abbreviation

Recombinant Chicken AVD protein

Gene Name

AVD

UniProt

P02701

Expression Region

25-152aa

Organism

Gallus gallus (Chicken)

Target Sequence

ARKCSLTGKWTNDLGSNMTIGAVNSRGEFTGTYITAVTATSNEIKESPLHGTQNTINKRTQPTFGFTVNWKFSESTTVFTGQCFIDRNGKEVLKTMWLLRSSVNDIGDDWKATRVGINIFTRLRTQKE

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

The biological function of avidin is not known. Forms a strong non-covalent specific complex with biotin (one molecule of biotin per subunit of avidin) .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

15.8 kDa

References & Citations

"Biochemical characterization and crystal structure of a recombinant hen avidin and its acidic mutant expressed in Escherichia coli." Nardone E., Rosano C., Santambrogio P., Curnis F., Corti A., Magni F., Siccardi A.G., Paganelli G., Losso R., Apreda B., Bolognesi M., Sidoli A., Arosio P. Eur. J. Biochem. 256:453-460 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyethylenimine (Branched) (Technical Grade)
TRC-P688508-25G 25 g

Polyethylenimine (Branched) (Technical Grade)

Sign In for Pricing
View Details
C19orf80 (ANGPTL8) Mouse Monoclonal Antibody [Clone ID: OTI1C6]
CF809011 100 µg

C19orf80 (ANGPTL8) Mouse Monoclonal Antibody [Clone ID: OTI1C6]

Sign In for Pricing
View Details
FGFR2 (NM_022970) Human Over-expression Lysate
LY402962 100 µg

FGFR2 (NM_022970) Human Over-expression Lysate

Sign In for Pricing
View Details
One-step TUNEL In Situ Apoptosis Kit (Red, Elab Fluor® 555)
E-CK-A325-01 20 Assays

One-step TUNEL In Situ Apoptosis Kit (Red, Elab Fluor® 555)

Sign In for Pricing
View Details
One-step TUNEL In Situ Apoptosis Kit (Red, Elab Fluor® 555)
E-CK-A325-02 100 Assays

One-step TUNEL In Situ Apoptosis Kit (Red, Elab Fluor® 555)

Sign In for Pricing
View Details
Tissue Protein Lysate, Prostate
CP565559 150 µg

Tissue Protein Lysate, Prostate

Sign In for Pricing
View Details