Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GITR, Canine (HEK293, His)

GITR is a type I transmembrane protein. GITR mediates signal transduction through NF-kB and MAPK pathways. Protects T cells from cell death induced by TCR activation. GITR inhibits proliferation and induces apoptosis of Multiple Myeloma (MM) cells in vitro and in vivo. GITR Protein, Canine (HEK293, His) is the recombinant canine-derived GITR protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

GITR Protein, Canine (HEK293, His), Canine, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gitr-protein-canine-hek293-his.html

Purity

95.0

Smiles

GAPSCGPGRLLRGTGTDARCCRPCAPGEAAEKVCPELDCTCVQPGFHCGDPQCKTCKHHTCPPGQEVRPHGNFNFGFECVDCAAGTFSGGQEGRCKPWSDCSQFGYPTTFPGNKTHNAVCSPGLPPTEPRDP

Molecular Formula

606971 (Gene_ID) D7F619 (G23-P154) (Accession)

Molecular Weight

19-25 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Telmisartan
S1738-50mg 50 mg

Telmisartan

Sign In for Pricing
View Details
GENLISA Rabbit Fat-Inducing Protein 1 (FITM1) ELISA
KLX1081 1x 96 Well

GENLISA Rabbit Fat-Inducing Protein 1 (FITM1) ELISA

Sign In for Pricing
View Details
HSF2, Human (His)
HY-P70406 1 Each

HSF2, Human (His)

Sign In for Pricing
View Details
2,2,3,3,4,4,5,5,6,6,6-Eicosalfluorohexan-1-ol
sc-260176 5 g

2,2,3,3,4,4,5,5,6,6,6-Eicosalfluorohexan-1-ol

Sign In for Pricing
View Details
Dok5 (NM_001163686) Mouse Tagged ORF Clone Lentiviral Particle
MR223379L4V 200 µL

Dok5 (NM_001163686) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PAI-1 Antibody
GWB-CDB21F 0.2 mg

PAI-1 Antibody

Sign In for Pricing
View Details