HSF2, Human (His)
As a DNA-binding protein, HSF2 protein has specific affinity for the heat shock promoter element (HSE), thereby activating transcription. Notably, in higher eukaryotes, the ability of HSF2 to bind to HSE depends on the exposure of cells to heat shock. HSF2 Protein, Human (His) is the recombinant human-derived HSF2 protein, expressed by E. coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
HSF2 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/hsf2-protein-human-his.html
Smiles
SENKGLETTKNNVVQPVSEEGRKSKSKPDKQLIQYTAFPLLAFLDGNPASSVEQASTTASSEVLSSVDKPIEVDELLDSSLDPEPTQSKLVRLEPLTEAEASEATLFYLCELAPAPLDSDMPLLDS
Molecular Formula
3298 (Gene_ID) Q03933 (S411-S536) (Accession)
Molecular Weight
Approximately 26 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
SLC30A9 (Solute Carrier Family 30 (Zinc Transporter), Member 9)
Nisin Q (lantibiotic, type 1, class 1 bacteriocins; Gram-positive bacteria; XXT; XXW)
Unc5d sgRNA CRISPR Lentivector (Rat) (Target 2)
