Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IgG1, Human (CHO, C103S)

The IgG1 protein is the constant region of the immunoglobulin heavy chain and serves as a receptor during the recognition phase of humoral immunity. It triggers clonal expansion and differentiation of B lymphocytes into immunoglobulin-secreting plasma cells. IgG1 Protein, Human (CHO, C103S) is the recombinant human-derived IgG1 protein, expressed by CHO , with tag free.

Product Specifications

Product Name Alternative

IgG1 Protein, Human (CHO, C103S), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igg1-protein-human-cho.html

Purity

97.00

Smiles

EPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Molecular Formula

3500 (Gene_ID) P01857-1 (E99-K330, C103S) (Accession)

Molecular Weight

Approximately 29-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral human UBXN6 shRNA (UAS) - Lentiviral human UBXN6 shRNA (UAS, GFP) plasmid
GTR15101182 1 Vial

Lentiviral human UBXN6 shRNA (UAS) - Lentiviral human UBXN6 shRNA (UAS, GFP) plasmid

Ask
View Details
(Z)-Hexadec-11-en-1-ol
TRC-H291114-50MG 50 mg

(Z)-Hexadec-11-en-1-ol

Ask
View Details
Rabbit Anti Human ABCG1 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(Western Blot, IHC, ELISA)
MBS8421760-01 0.12 mL

Rabbit Anti Human ABCG1 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(Western Blot, IHC, ELISA)

Ask
View Details
Rabbit Anti Human ABCG1 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(Western Blot, IHC, ELISA)
MBS8421760-02 0.2 mL

Rabbit Anti Human ABCG1 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(Western Blot, IHC, ELISA)

Ask
View Details
Rabbit Anti Human ABCG1 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(Western Blot, IHC, ELISA)
MBS8421760-03 5x 0.2 mL

Rabbit Anti Human ABCG1 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(Western Blot, IHC, ELISA)

Ask
View Details
Bovine Heat shock cognate 71 kDa protein, HSPA8 ELISA KIT
ELI-03581b 96 Tests

Bovine Heat shock cognate 71 kDa protein, HSPA8 ELISA KIT

Ask
View Details