Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Hereditary hemochromatosis protein homolog (Hfe)

Product Specifications

Product Name Alternative

/

Abbreviation

Recombinant Mouse Hfe protein

Gene Name

Hfe

UniProt

P70387

Expression Region

25-359aa

Organism

Mus musculus (Mouse)

Target Sequence

QALPPRSHSLRYLFMGASEPDLGLPLFEARGYVDDQLFVSYNHESRRAEPRAPWILEQTSSQLWLHLSQSLKGWDYMFIVDFWTIMGNYNHSKVTKLGVVSESHILQVVLGCEVHEDNSTSGFWRYGYDGQDHLEFCPKTLNWSAAEPGAWATKVEWDEHKIRAKQNRDYLEKDCPEQLKRLLELGRGVLGQQVPTLVKVTRHWASTGTSLRCQALDFFPQNITMRWLKDNQPLDAKDVNPEKVLPNGDETYQGWLTLAVAPGDETRFTCQVEHPGLDQPLTASWEPLQSQAMIIGIISGVTVCAIFLVGILFLILRKRKASGGTMGGYVLTDCE

Tag

N-terminal 10xHis-tagged

Type

CF Transmembrane Protein & Developed Protein

Source

In vitro E.coli expression system

Field of Research

Metabolism

Relevance

Binds to transferrin receptor (TFR) and reduces its affinity for iron-loaded transferrin.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

39.5 kDa

References & Citations

"Experimental hemochromatosis due to MHC class I HFE deficiency: immune status and iron metabolism." Bahram S., Gilfillan S., Kuhn L.C., Moret R., Schulze J.B., Lebeau A., Schumann K. Proc. Natl. Acad. Sci. U.S.A. 96:13312-13317 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-DARPP32 (Thr75) Rabbit pAb
E47R3119 100 µL

Phospho-DARPP32 (Thr75) Rabbit pAb

Sign In for Pricing
View Details
Mouse Monoclonal GPR64 Antibody (864238) [DyLight 680]
FAB79771Y 0.1 mL

Mouse Monoclonal GPR64 Antibody (864238) [DyLight 680]

Sign In for Pricing
View Details
Purified Anti-Human CD11c Antibody[3.9]
E-AB-F1486A-01 25 µg

Purified Anti-Human CD11c Antibody[3.9]

Sign In for Pricing
View Details
Purified Anti-Human CD11c Antibody[3.9]
E-AB-F1486A-02 100 µg

Purified Anti-Human CD11c Antibody[3.9]

Sign In for Pricing
View Details
Purified Anti-Human CD11c Antibody[3.9]
E-AB-F1486A-03 1 mg

Purified Anti-Human CD11c Antibody[3.9]

Sign In for Pricing
View Details
Purified Anti-Human CD11c Antibody[3.9]
E-AB-F1486A-04 5 mg

Purified Anti-Human CD11c Antibody[3.9]

Sign In for Pricing
View Details