Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BMP-2, Zebrafish

Bone morphogenetic protein 2 (BMP-2) is a pleiotropic ligand protein belonging to TGFβ family, and is involved in key embryonic development of vascular and valvular homeostasis. BMP-2 binds to type I receptors (ALK-2/-3/-6) and type II receptors (BMPR2, ACVR2A) to regulate various types of calcification, including atherosclerosis, chronic kidney disease, diabetes, and valve calcification[1]. BMP-2 is overexpressed by myofibroblast and preosteoblast in the calcified area of human calcified valve, which are densely infiltrated by B lymphocytes and T lymphocytes[5]. BMP-2 is the junction between atherosclerotic vascular calcification and normal bone formation mechanism[6]. Zebrafish BMP-2 Protein has a length of 386 a.a., BMP-2 Protein, Zebrafish is 105 a.a. (Q272-R386), expressed in E. coli cells with tag free.

Product Specifications

Product Name Alternative

BMP-2 Protein, Zebrafish, Others, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bmp-2-protein-zebrafish.html

Purity

97.20

Smiles

QARNNKQRKKHKANCRRHSLYVDFSDVGWNDWIVAPPGYHAFYCQGECPFPLADHLNSTNHAIVQTLVNSVNSNIPRACCVPTDLSPVSLLYLDEYERVILKNYQDMVVEGCGCR

Molecular Formula

/ (Gene_ID) B3DI86 (Q272-R386) (Accession)

Molecular Weight

Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Yang P, et al. The role of bone morphogenetic protein signaling in vascular calcification. Bone. 2020 Dec;141:115542.|[2]Miyazawa K, et al. Regulation of TGF-β Family Signaling by Inhibitory Smads. Cold Spring Harb Perspect Biol. 2017 Mar 1;9 (3) :a022095.|[3]Simões Sato AY, et al. BMP-2 and -4 produced by vascular smooth muscle cells from atherosclerotic lesions induce monocyte chemotaxis through direct BMPRII activation. Atherosclerosis. 2014 Jul;235 (1) :45-55.|[4]Boström K, et al. Bone morphogenetic protein expression in human atherosclerotic lesions. J Clin Invest. 1993 Apr;91 (4) :1800-9.|[5]Mohler ER 3rd, et al. Bone formation and inflammation in cardiac valves. Circulation. 2001 Mar 20;103 (11) :1522-8.|[6]Demer LL, et al. Mechanism of calcification in atherosclerosis. Trends Cardiovasc Med. 1994 Jan-Feb;4 (1) :45-9.|[7]David L, et al. Emerging role of bone morphogenetic proteins in angiogenesis. Cytokine Growth Factor Rev. 2009 Jun;20 (3) :203-12.|[8]Liberman M, et al. Bone morphogenetic protein-2 activates NADPH oxidase to increase endoplasmic reticulum stress and human coronary artery smooth muscle cell calcification. Biochem Biophys Res Commun. 2011 Sep 30;413 (3) :436-41.|[9]Hoodless PA, et al. MADR1, a MAD-related protein that functions in BMP2 signaling pathways. Cell. 1996 May 17;85 (4) :489-500.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-GPR123 ADGRA1 Antibody
A14766 100 µL

Anti-GPR123 ADGRA1 Antibody

Sign In for Pricing
View Details
SMAD2 Antibody, mAb, Rabbit
A02498-50 50 µL

SMAD2 Antibody, mAb, Rabbit

Sign In for Pricing
View Details
Anti-Eg5 Rabbit Monoclonal Antibody, Carrier-free
M01754-3-carrier-free 100 µL

Anti-Eg5 Rabbit Monoclonal Antibody, Carrier-free

Sign In for Pricing
View Details
Akt1 (Phospho-Thr450) Antibody
8A0406-AAT 50 µg

Akt1 (Phospho-Thr450) Antibody

Sign In for Pricing
View Details
Recombinant Secreted Frizzled Related Protein 4 (SFRP4)
TRV-0013512-01 10 µg

Recombinant Secreted Frizzled Related Protein 4 (SFRP4)

Sign In for Pricing
View Details
Recombinant Secreted Frizzled Related Protein 4 (SFRP4)
TRV-0013512-02 50 µg

Recombinant Secreted Frizzled Related Protein 4 (SFRP4)

Sign In for Pricing
View Details