Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SDF-1 beta/CXCL12, Mouse

SDF-1 beta (Stromal-derived factor-1β, SDF-1β) is a stromal derived CXC chemokine that signal through the CXCR4 receptor. SDF-1β has chemotactic activity on B and T cells[1][2]. SDF-1 beta/CXCL12 Protein, Mouse is produced in E. coli, and consists of 72 amino acids (K22-M93) .

Product Specifications

Product Name Alternative

SDF-1 beta/CXCL12 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cxcl12-sdf-1-beta-protein-mouse.html

Purity

98.0

Smiles

KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRLKM

Molecular Formula

20315 (Gene_ID) P40224-2 (K22-M93) (Accession)

Molecular Weight

Approximately 10 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Maria De La Luz Sierra, et al. Differential processing of stromal-derived factor-1alpha and stromal-derived factor-1beta explains functional diversity. Blood. 2004 Apr 1;103 (7) :2452-9.|[2]Zheng Jiang, et al. Contribution of SDF-1α/CXCR4 signaling to brain development and glioma progression. Neurosignals. 2013;21 (3-4) :240-58.|[3]Miroslaw Janowski. Functional diversity of SDF-1 splicing variants. Cell Adh Migr. 2009 Jul-Sep;3 (3) :243-9.|[4]Kleanthis Fytianos, et al. Anti-Fibrotic Effect of SDF-1β Overexpression in Bleomycin-Injured Rat Lung. Pharmaceutics. 2022 Aug 27;14 (9) :1803.|[5]Yuanyuan Tian, et al. KLF15 negatively regulates cardiac fibrosis by which SDF-1β attenuates cardiac fibrosis in type 2 diabetic mice. Toxicol Appl Pharmacol. 2021 Sep 15;427:115654.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

DR5 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-7352R-BF350 100 µL

DR5 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Ask
View Details
Lentiviral mouse Sclt1 shRNA (UAS) - Lentiviral mouse Sclt1 shRNA (UAS, RFP) (100)
GTR15173208 1 Vial

Lentiviral mouse Sclt1 shRNA (UAS) - Lentiviral mouse Sclt1 shRNA (UAS, RFP) (100)

Ask
View Details
Recombinant Vibrio fischeri Lysine--tRNA ligase (lysS), partial
MBS1196270-01 0.05 mg (E-Coli)

Recombinant Vibrio fischeri Lysine--tRNA ligase (lysS), partial

Ask
View Details
Recombinant Vibrio fischeri Lysine--tRNA ligase (lysS), partial
MBS1196270-02 0.05 mg (Baculovirus)

Recombinant Vibrio fischeri Lysine--tRNA ligase (lysS), partial

Ask
View Details
Recombinant Vibrio fischeri Lysine--tRNA ligase (lysS), partial
MBS1196270-03 0.2 mg (E-Coli)

Recombinant Vibrio fischeri Lysine--tRNA ligase (lysS), partial

Ask
View Details
Recombinant Vibrio fischeri Lysine--tRNA ligase (lysS), partial
MBS1196270-04 0.2 mg (Yeast)

Recombinant Vibrio fischeri Lysine--tRNA ligase (lysS), partial

Ask
View Details