Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZBTB12 Rabbit Polyclonal Antibody (FITC)

ZBTB12 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

G10, Bat9, NG35, D6S59E, C6orf46

UniProt

Q9Y330

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZBTB12

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MASGVEVLRFQLPGHEAATLRNMNQLRAEERFCDVTIVADSLKFRGHKVI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_862825

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nucleus And Mitotic Cell Antigen (FITC) discontinued
N7200-FITC 100 µL

Nucleus And Mitotic Cell Antigen (FITC) discontinued

Sign In for Pricing
View Details
RNASE10 sgRNA CRISPR Lentivector (Human) (Target 3)
K1832004 1.0 µg DNA

RNASE10 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Canine pro-melanin-concentrating hormone, PMCH ELISA KIT
E0368Ca-01 48 Well

Canine pro-melanin-concentrating hormone, PMCH ELISA KIT

Sign In for Pricing
View Details
Canine pro-melanin-concentrating hormone, PMCH ELISA KIT
E0368Ca-02 96 Well

Canine pro-melanin-concentrating hormone, PMCH ELISA KIT

Sign In for Pricing
View Details
Canine pro-melanin-concentrating hormone, PMCH ELISA KIT
E0368Ca-03 5x 96 Tests

Canine pro-melanin-concentrating hormone, PMCH ELISA KIT

Sign In for Pricing
View Details
Canine pro-melanin-concentrating hormone, PMCH ELISA KIT
E0368Ca-04 10x 96 Tests

Canine pro-melanin-concentrating hormone, PMCH ELISA KIT

Sign In for Pricing
View Details