TM4SF2/TSPAN7, Mouse (HEK293, His)
The TM4SF2/TSPAN7 protein may be involved in cell proliferation and motility and play a role in regulating these processes, but the specific mechanism remains unclear. Its involvement in proliferation suggests importance for cell growth, while its role in motility suggests a potential contribution to cell motility and migration. TM4SF2/TSPAN7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TM4SF2/TSPAN7 protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
TM4SF2/TSPAN7 Protein, Mouse (HEK293, His), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/tm4sf2-tspan7-protein-mouse-hek293-his.html
Purity
95.60
Smiles
RHEIKDTFLRTYTDAMQNYNGNDERSRAVDHVQRSLSCCGVQNYTNWSSSPYFLDHGIPPSCCMNETDCNPLDLHNLTVAATKVNQKGCYDLVTSFMETNM
Molecular Formula
21912 (Gene_ID) Q62283 (R113-M213) (Accession)
Molecular Weight
Approximately 19-30 kDa due to the glycosylation
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
NOX4 (Nicotinamide Adenine Dinucleotide Phosphate Oxidase 4) BioAssayTM ELISA Kit (Mouse) discontinued
NOX4 (Nicotinamide Adenine Dinucleotide Phosphate Oxidase 4) BioAssayTM ELISA Kit (Mouse) discontinued
Bovine Pulmonary surfactant-associated protein B ELISA Kit
