Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP1R9A Rabbit Polyclonal Antibody (HRP)

PPP1R9A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NRB1, NRBI, Neurabin-I

UniProt

B2RWQ1

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human PPP1R9A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GERTTLRSASPHRNAYRTEFQALKSTFDKPKSDGEQKTKEGEGSQQSRGR

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

151kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001159632

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal PSGL-1/CD162 Antibody (688101) [mFluor Violet 500 SE]
FAB9961MFV500 0.1 mL

Mouse Monoclonal PSGL-1/CD162 Antibody (688101) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
EAF2 Protein Vector (Human) (pPM-C-His)
PV013452 500 ng

EAF2 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
IL12B Antibody (Biotin)
orb239603-01 50 µg

IL12B Antibody (Biotin)

Sign In for Pricing
View Details
IL12B Antibody (Biotin)
orb239603-02 100 µg

IL12B Antibody (Biotin)

Sign In for Pricing
View Details
ALF (General Transcription Factor IIA, 1-like, ALF, MGC26254) (MaxLight 650)
243264-ML650 100 µL

ALF (General Transcription Factor IIA, 1-like, ALF, MGC26254) (MaxLight 650)

Sign In for Pricing
View Details
Rabbit Monoclonal Ubiquitin B Antibody (UBB/3143R) [Alexa Fluor 594]
NBP3-08907AF594 100 µL

Rabbit Monoclonal Ubiquitin B Antibody (UBB/3143R) [Alexa Fluor 594]

Sign In for Pricing
View Details