Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Serpin B3, Human (HEK293, His)

The Serpin B3 protein exhibits versatility in cellular regulation and may act as a papain-like cysteine protease inhibitor to modulate immune responses against tumor cells. Its dual role extends to inhibiting UV-induced apoptosis by inhibiting c-Jun NH (2) -terminal kinase (JNK1) activity, suggesting that Serpin B3 is involved in the stress response. Serpin B3 Protein, Human (HEK293, His) is the recombinant human-derived Serpin B3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Serpin B3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/serpin-b3-protein-human-hek-293-his.html

Purity

98.0

Smiles

MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTGKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP

Molecular Formula

6317 (Gene_ID) P29508 (M1-P390) (Accession)

Molecular Weight

41-50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goose Phospho Cytochrome P450 1A1 (PCYP1A1) ELISA Kit
MBS9345339 Inquire

Goose Phospho Cytochrome P450 1A1 (PCYP1A1) ELISA Kit

Sign In for Pricing
View Details
STK11 Protein Vector (Human) (pPB-C-His)
PV040525 500 ng

STK11 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
OAZ1 Blocking Peptide
CBP4137-01 1 mg

OAZ1 Blocking Peptide

Sign In for Pricing
View Details
OAZ1 Blocking Peptide
CBP4137-02 5 mg

OAZ1 Blocking Peptide

Sign In for Pricing
View Details
DNMBP (KIAA1010, Dynamin-binding Protein, Scaffold Protein Tuba) (AP) discontinued
125968-AP 100 µL

DNMBP (KIAA1010, Dynamin-binding Protein, Scaffold Protein Tuba) (AP) discontinued

Sign In for Pricing
View Details
Anti-FCER1G Antibody, Rabbit Polyclonal
MBS8126487-01 0.1 mL

Anti-FCER1G Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details