Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Serpin B3, Human (HEK293, His)

The Serpin B3 protein exhibits versatility in cellular regulation and may act as a papain-like cysteine protease inhibitor to modulate immune responses against tumor cells. Its dual role extends to inhibiting UV-induced apoptosis by inhibiting c-Jun NH (2) -terminal kinase (JNK1) activity, suggesting that Serpin B3 is involved in the stress response. Serpin B3 Protein, Human (HEK293, His) is the recombinant human-derived Serpin B3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Serpin B3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/serpin-b3-protein-human-hek-293-his.html

Purity

98.0

Smiles

MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTGKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP

Molecular Formula

6317 (Gene_ID) P29508 (M1-P390) (Accession)

Molecular Weight

41-50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARHGDIA Antibody
DF6346-01 100 µL

ARHGDIA Antibody

Sign In for Pricing
View Details
ARHGDIA Antibody
DF6346-02 200 µL

ARHGDIA Antibody

Sign In for Pricing
View Details
Thrombospondin 4 Polyclonal Antibody
UB-GEN-16519 100 µL

Thrombospondin 4 Polyclonal Antibody

Sign In for Pricing
View Details
FAU Protein Vector (Mouse) (pPB-C-His)
PV178430 500 ng

FAU Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
p-Coumaroylagmatine-D₈
TRC-C979471-10MG 10 mg

p-Coumaroylagmatine-D₈

Sign In for Pricing
View Details
Cuzd1 (NM_054005) Rat Tagged ORF Clone Lentiviral Particle
RR215524L4V 200 µL

Cuzd1 (NM_054005) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details