Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GMP FGF basic/bFGF, Human

FGF-2 is a member of the fibroblast family involved in bone healing, cartilage repair, bone repair, and nerve regeneration. FGF-2 is also a mitotic promoter that accelerates cell proliferation. FGF-2 regulates immune processes by specifically targeting tyrosine kinase receptors and activating the FGF/FGFR signaling pathway. For example, FGF-2 is involved in the JAK-STAT signaling pathway to regulate cartilage metabolism and also activates ERK signaling to promote cartilage regeneration. FGF-2 combined with FGFR1/3 promoted degeneration and repair of articular cartilage, respectively[1]. FGF-2 is also a known carcinogen in GBM, which contributes to glioma growth and vascularization[2].GMP FGF basic/bFGF Protein, Human, consists of 157 amino acids, produced by E.coli with tag free.

Product Specifications

Product Name Alternative

GMP FGF basic/bFGF Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gmp-fgf-basic-bfgf-protein-human.html

Purity

98.0

Smiles

GTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Molecular Formula

2247 (Gene_ID) P09038-4 (G132-S288) (Accession)

Molecular Weight

Approximately 16 kDa

References & Citations

[1]Zhang J, et al. FGF2: a key regulator augmenting tendon-to-bone healing and cartilage repair. Regen Med. 2020 Sep;15 (9) :2129-2142.|[2]Jimenez-Pascual A, et al. FGF2: a novel druggable target for glioblastoma? Expert Opin Ther Targets. 2020 Apr;24 (4) :311-318.|[3]Hankemeier S, et al. Modulation of proliferation and differentiation of human bone marrow stromal cells by fibroblast growth factor 2: potential implications for tissue engineering of tendons and ligaments. Tissue Eng. 2005 Jan-Feb;11 (1-2) :41-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SARS-CoV-2 Spike S2 Antibody, Human IgG4 (AS86)
S2N-S86-100ug 100 µg

Anti-SARS-CoV-2 Spike S2 Antibody, Human IgG4 (AS86)

Sign In for Pricing
View Details
PAFAH1P1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1588006 1.0 µg DNA

PAFAH1P1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
IFI6 (NM_002038) Human Over-expression Lysate
E45H05994-2 20 µg

IFI6 (NM_002038) Human Over-expression Lysate

Sign In for Pricing
View Details
Active Recombinant Mouse Tnfrsf17 Protein, Fc-tagged, FITC conjugated
Tnfrsf17-661MF 20 μg- 50 μg- 100 μg

Active Recombinant Mouse Tnfrsf17 Protein, Fc-tagged, FITC conjugated

Sign In for Pricing
View Details
TMEM175 antibody
MBS5300650-01 0.05 mL

TMEM175 antibody

Sign In for Pricing
View Details
TMEM175 antibody
MBS5300650-02 5x 0.05 mL

TMEM175 antibody

Sign In for Pricing
View Details