Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCL24/Eotaxin-2, Human (HEK293, His)

CCL24/Eotaxin-2 Protein, Human (HEK293, His) is a CC chemokine that interacts with the chemokine receptor CCR3 to induce eosinophil chemotaxis and mediate atopic diseases, parasitic infections and systemic diseases, as well as promote cellular transport and regulate inflammatory and fibrotic activities. CCL24/Eotaxin-2 Protein, Human (HEK293, His) is a recombinant human CCL24/Eotaxin-2 (V27-C119) protein expressed by HEK293 with a his tag[1].

Product Specifications

Product Name Alternative

CCL24/Eotaxin-2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ccl24-eotaxin-2-protein-human-hek293-his.html

Purity

98.0

Smiles

VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTCHHHHHH

Molecular Formula

6369 (Gene_ID) O00175 (V27-C119) (Accession)

Molecular Weight

Approximately 18-23 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Amanda K Huber, et al. An emerging role for eotaxins in neurodegenerative disease. Clin Immunol. 2018 Apr;189:29-33.|[2]Adi Mor. et al. Blockade of CCL24 with a monoclonal antibody ameliorates experimental dermal and pulmonary fibrosis. Ann Rheum Dis. 2019 Sep;78 (9) :1260-1268.|[3]Hui Li, et al. Trophoblasts-derived chemokine CCL24 promotes the proliferation, growth and apoptosis of decidual stromal cells in human early pregnancy. Int J Clin Exp Pathol. 2013 May 15;6 (6) :1028-37.|[4]Michal Segal-Salto, et al. A blocking monoclonal antibody to CCL24 alleviates liver fibrosis and inflammation in experimental models of liver damage. JHEP Rep. 2020 Jan 2;2 (1) :100064.|[5]Andrew Menzies-Gow, et al. Eotaxin (CCL11) and eotaxin-2 (CCL24) induce recruitment of eosinophils, basophils, neutrophils, and macrophages as well as features of early- and late-phase allergic reactions following cutaneous injection in human atopic and nonatopic volunteers. J Immunol. 2002 Sep 1;169 (5) :2712-8.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC30 Peptide - C-terminal region
orb2003524 100 µg

CCDC30 Peptide - C-terminal region

Sign In for Pricing
View Details
Rat EGF (Epidermal Growth Factor) CLIA Kit
MBS2531413-01 96 Tests

Rat EGF (Epidermal Growth Factor) CLIA Kit

Sign In for Pricing
View Details
Rat EGF (Epidermal Growth Factor) CLIA Kit
MBS2531413-02 5x 96 Tests

Rat EGF (Epidermal Growth Factor) CLIA Kit

Sign In for Pricing
View Details
Di-O-benzoyl-D-tartaric Acid
TRC-D417325-50G 50 g

Di-O-benzoyl-D-tartaric Acid

Sign In for Pricing
View Details
OR7C1 Human shRNA Plasmid Kit (Locus ID 26664)
TL302763 1 Kit

OR7C1 Human shRNA Plasmid Kit (Locus ID 26664)

Sign In for Pricing
View Details
OAT1
402763-01 50 µL

OAT1

Sign In for Pricing
View Details