Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC30 Peptide - C-terminal region

CCDC30 Peptide - C-terminal region

Product Specifications

UniProt

Q5VVM6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC30 Rabbit Polyclonal Antibody (orb587824) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GKGLVESFASLQETEEIKSKEAMASSKSPEKSPENLVCSQNSEAGYINVA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Tumor Necrosis Factor Related Apoptosis Inducing Ligand (TRAIL) CLIA Kit
abx496356-01 96 Tests

Mouse Tumor Necrosis Factor Related Apoptosis Inducing Ligand (TRAIL) CLIA Kit

Sign In for Pricing
View Details
Mouse Tumor Necrosis Factor Related Apoptosis Inducing Ligand (TRAIL) CLIA Kit
abx496356-02 5x 96 Tests

Mouse Tumor Necrosis Factor Related Apoptosis Inducing Ligand (TRAIL) CLIA Kit

Sign In for Pricing
View Details
Mouse Tumor Necrosis Factor Related Apoptosis Inducing Ligand (TRAIL) CLIA Kit
abx496356-03 10x 96 Tests

Mouse Tumor Necrosis Factor Related Apoptosis Inducing Ligand (TRAIL) CLIA Kit

Sign In for Pricing
View Details
SH2D1B (NM_053282) Human Untagged Clone
SC125856 10 µg

SH2D1B (NM_053282) Human Untagged Clone

Sign In for Pricing
View Details
TRNAE40P Protein Lysate (Human) with C-Ha Tag
48008031 100 µg

TRNAE40P Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
HPV ID-15 Screening qPCR Kit
CFP07 100 Tests

HPV ID-15 Screening qPCR Kit

Sign In for Pricing
View Details