Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-9, Mouse (His, solution)

FGF-9 Protein, Mouse (His, solution) is a member of mouse fibroblast growth factors, Plays an important role in brain development and functions.

Product Specifications

Product Name Alternative

FGF-9 Protein, Mouse (His, solution), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-9-protein-mouse.html

Purity

98.0

Smiles

MAPLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS

Molecular Formula

14180 (Gene_ID) P54130 (M1-S208) (Accession)

Molecular Weight

Approximately 25 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Yusuf IO, et al. Fibroblast Growth Factor 9 Suppresses Striatal Cell Death Dominantly Through ERK Signaling in Huntington's Disease. Cell Physiol Biochem. 2018;48 (2) :605-617.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARSB Peptide - C-terminal region
orb2001097 100 µg

ARSB Peptide - C-terminal region

Sign In for Pricing
View Details
Mouse Carboxyterminal propeptide of type I procollagen (PICP) ELISA Kit
orb1654795-01 48 Tests

Mouse Carboxyterminal propeptide of type I procollagen (PICP) ELISA Kit

Sign In for Pricing
View Details
Mouse Carboxyterminal propeptide of type I procollagen (PICP) ELISA Kit
orb1654795-02 96 Tests

Mouse Carboxyterminal propeptide of type I procollagen (PICP) ELISA Kit

Sign In for Pricing
View Details
SLC30A10 Antibody (C-term) Blocking Peptide
MBS9224189-01 0.5 mg

SLC30A10 Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details
SLC30A10 Antibody (C-term) Blocking Peptide
MBS9224189-02 5x 0.5 mg

SLC30A10 Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details
Recombinant Xenopus laevis Secretory carrier-associated membrane protein 5A (scamp5-a)
MBS7029304-01 0.02 mg

Recombinant Xenopus laevis Secretory carrier-associated membrane protein 5A (scamp5-a)

Sign In for Pricing
View Details