Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARSB Peptide - C-terminal region

ARSB Peptide - C-terminal region

Product Specifications

Product Name Alternative

ASB, G4S, MPS6

UniProt

P15848

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARSB Rabbit Polyclonal Antibody (orb588213) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000037.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSREYPHIVTKLLSRLQFY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Armc12 Mouse Gene Knockout Kit (CRISPR)
KN501588 1 Kit

Armc12 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
rac 4-(3-Aminobutyl)phenol-d6
TRC-A602502-25MG 25 mg

rac 4-(3-Aminobutyl)phenol-d6

Sign In for Pricing
View Details
CYFIP2 Human qPCR Primer Pair (NM_014376)
HP228479 200 Reactions

CYFIP2 Human qPCR Primer Pair (NM_014376)

Sign In for Pricing
View Details
Recombinant PGK1 Antibody
RC-5210-01 50 μL

Recombinant PGK1 Antibody

Sign In for Pricing
View Details
Recombinant PGK1 Antibody
RC-5210-02 100 µL

Recombinant PGK1 Antibody

Sign In for Pricing
View Details
Recombinant PGK1 Antibody
RC-5210-03 1 mL

Recombinant PGK1 Antibody

Sign In for Pricing
View Details