Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALK-1, Canine (HEK293, Fc)

ALK-1, also known as ACVRL1, is a type I receptor for TGF-β superfamily with 2 ligands, BMP9 and BMP10. ALK-1 is predominantly expressed in endothelial cells and plays a critical role in regulating developmental and pathological angiogenesis[1][2]. ALK-1 Protein, Canine (HEK293, Fc) is produced in HEK293 cells with a C-Terminal Fc-tag. It consists of 119 amino acids (M1-K119) .

Product Specifications

Product Name Alternative

ALK-1 Protein, Canine (HEK293, Fc), Canine, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/alk-1-protein-canine-hek293-fc.html

Purity

98.00

Smiles

GNPVKPSRGPLLTCTCESPHCRGPTCQGTWCTVVLVREEGRHPQEHRGCGNLNEELCRGRPTEFVNHYCCYSPLCNHNVSLVLEATQIPPEQPKVDGQ

Molecular Formula

/ (Gene_ID) E2R174 (G22-K119) (Accession)

Molecular Weight

43-47 kDa

References & Citations

[1]S P Oh, et al. Activin receptor-like kinase 1 modulates transforming growth factor-beta 1 signaling in the regulation of angiogenesis. Proc Natl Acad Sci U S A. 2000 Mar 14;97 (6) :2626-31.|[2]Dianyuan Zhao, et al. ALK1 signaling is required for the homeostasis of Kupffer cells and prevention of bacterial infection. J Clin Invest. 2022 Feb 1;132 (3) :e150489.|[3]Dianne Mitchell, et al. ALK1-Fc inhibits multiple mediators of angiogenesis and suppresses tumor growth. Mol Cancer Ther. 2010 Feb;9 (2) :379-88.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr119 CRISPRa sgRNA lentivector (set of three targets)(Rat)
33728126 3x 1.0µg DNA

Olr119 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
ARL1 Rabbit Polyclonal Antibody
E28PN5922 100 µL

ARL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit cTnT/TNNT2 (Troponin T Type 2, Cardiac) ValidElisa Kit
EK346669 96 Well

Rabbit cTnT/TNNT2 (Troponin T Type 2, Cardiac) ValidElisa Kit

Sign In for Pricing
View Details
KCTD17 Peptide - middle region
orb1999041 100 µg

KCTD17 Peptide - middle region

Sign In for Pricing
View Details
Mavacoxib-d4
sc-488034 1 mg

Mavacoxib-d4

Sign In for Pricing
View Details
WTAP Double Nickase Plasmid (bovine2)
sc-437360-NIC-2 20 µg

WTAP Double Nickase Plasmid (bovine2)

Sign In for Pricing
View Details