KCTD17 Peptide - middle region
KCTD17 Peptide - middle region
Product Specifications
UniProt
Q8N5Z5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001269613.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DQAEFLCVVSKELHSTPNGLSSESSRKTKSTEEQLEEQQQQEEEVEEVEV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
15383121 3x 1.0µg DNA
CCNB1IP1 CRISPRa sgRNA lentivector (set of three targets)(Human)
Sign In for Pricing
View Details 
GTR10410517 96 Well
Human Protein C Receptor, Endothelial ELISA kit
Sign In for Pricing
View Details MBS2005155-01 0.1 mL
Polyclonal Antibody to Ribonuclease T2 (RNASET2)
Sign In for Pricing
View Details MBS2005155-02 0.2 mL
Polyclonal Antibody to Ribonuclease T2 (RNASET2)
Sign In for Pricing
View Details MBS2005155-03 0.5 mL
Polyclonal Antibody to Ribonuclease T2 (RNASET2)
Sign In for Pricing
View Details