Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Solute carrier family 22 member 1 (SLC22A1), partial

Product Specifications

Product Name Alternative

(Organic cation transporter 1) (hOCT1)

Abbreviation

Recombinant Human SLC22A1 protein, partial

Gene Name

SLC22A1

UniProt

O15245

Expression Region

43-149aa

Organism

Homo sapiens (Human)

Target Sequence

GFTPDHHCQSPGVAELSQRCGWSPAEELNYTVPGLGPAGEAFLGQCRRYEVDWNQSALSCVDPLASLATNRSHLPLGPCQDGWVYDTPGSSIVTEFNLVCADSWKLD

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Translocates a broad array of organic cations with various structures and molecular weights including the model compounds 1-methyl-4-phenylpyridinium (MPP), tetraethylammonium (TEA), N-1-methylnicotinamide (NMN), 4- (4- (dimethylamino) styryl) -N-methylpyridinium (ASP), the endogenous compounds choline, guanidine, histamine, epinephrine, adrenaline, noradrenaline and dopamine, and the drugs quinine, and metformin. The transport of organic cations is inhibited by a broad array of compounds like tetramethylammonium (TMA), cocaine, lidocaine, NMDA receptor antagonists, atropine, prazosin, cimetidine, TEA and NMN, guanidine, cimetidine, choline, procainamide, quinine, tetrabutylammonium, and tetrapentylammonium. Translocates organic cations in an electrogenic and pH-independent manner. Translocates organic cations across the plasma membrane in both directions. Transports the polyamines spermine and spermidine. Transports pramipexole across the basolateral membrane of the proximal tubular epithelial cells. The choline transport is activated by MMTS. Regulated by various intracellular signaling pathways including inhibition by protein kinase A activation, and endogenously activation by the calmodulin complex, the calmodulin-dependent kinase II and LCK tyrosine kinase. Mediates the transport of prostaglandin E2 (PGE2) and prostaglandin F2-alpha (PGF2-alpha) and may be involved in their renal excretion.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

24.5 kDa

References & Citations

"Drug specificity and intestinal membrane localization of human organic cation transporters (OCT) ." Mueller J., Lips K.S., Metzner L., Neubert R.H.H., Koepsell H., Brandsch M. Biochem. Pharmacol. 70:1851-1860 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uridine-5'-O- (3-thiotriphosphate)
HY-137603 1 Each

Uridine-5'-O- (3-thiotriphosphate)

Sign In for Pricing
View Details
CERK Antibody, Biotin conjugated
A17095-100UG 100 µg

CERK Antibody, Biotin conjugated

Sign In for Pricing
View Details
1- (3-bromobenzyl) -1H-pyrazol-5-amine hydrochloride
sc-332507 250 mg

1- (3-bromobenzyl) -1H-pyrazol-5-amine hydrochloride

Sign In for Pricing
View Details
RGD1308470 ORF Vector (Rat) (pORF)
ORF074886 1.0 µg DNA

RGD1308470 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
C14orf126, CT (C14orf126, Probable D-tyrosyl-tRNA (Tyr) deacylase 2) (PE) discontinued
032713-PE 200 µL

C14orf126, CT (C14orf126, Probable D-tyrosyl-tRNA (Tyr) deacylase 2) (PE) discontinued

Sign In for Pricing
View Details
PDE3B Rabbit pAb (APR28235N)
APR28235N-01 50 µL

PDE3B Rabbit pAb (APR28235N)

Sign In for Pricing
View Details