Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human IL12P40&P19 Heterodimer Protein (Active)

Product Specifications

Product Name Alternative

SGRF; IL-23p19; CLMF p40; IL-12 subunit p40; NKSF2

Abbreviation

Recombinant Human IL12P40&P19 Heterodimer protein (Active)

Gene Name

IL12P40&P19

UniProt

P29460&AAG37232

Expression Region

23-328aa (IL12P40) &20-189aa (P19)

Organism

Homo sapiens (Human)

Target Sequence

IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS&RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP

Tag

Tag free

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Others

Endotoxin

≤10 EU/mg by the LAL method

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its ability to induce Interferon gamma secretion by human natural killer lymphoma NK-92 cells. The ED50 for this effect is <0.5 μg/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

55.0 kDa (IL-23 single chain) ; 36.5 kDa (p40) & 18.5 kDa (p19)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Heterodimer

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmsb15a Mouse Gene Knockout Kit (CRISPR)
KN517948 1 Kit

Tmsb15a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (MUC1/955), CF568 conjugate, 0.1mg/mL
BNC680955-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (MUC1/955), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OR5B3 Antibody
8G627-AAT 50 µg

OR5B3 Antibody

Sign In for Pricing
View Details
Tyk2 Mouse Gene Knockout Kit (CRISPR)
KN518524 1 Kit

Tyk2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human Ephrin-A5/EFNA5 Protein (Fc Tag)
PKSH032393-01 10 µg

Recombinant Human Ephrin-A5/EFNA5 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human Ephrin-A5/EFNA5 Protein (Fc Tag)
PKSH032393-02 50 µg

Recombinant Human Ephrin-A5/EFNA5 Protein (Fc Tag)

Sign In for Pricing
View Details