Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANTES/CCL5, Mouse (HEK293, Fc)

RANTES/CCL5 Protein, Mouse (HEK293, Fc) is a key pro-inflammatory chemokine in the CC chemokine family that interacts with CCR1, CCR3, CCR4, and CCR5 to mediate inflammatory immune responses, viral infections, and tumorigenesis.RANTES/CCL5 Protein, Mouse (HEK293, Fc) is a recombinant mouse RANTES/CCL5 (S24-S91) protein expressed by HEK293 with a hFc tag at the N-terminu[1].

Product Specifications

Product Name Alternative

RANTES/CCL5 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rantes-ccl5-protein-mouse-hek293-fc.html

Purity

95.00

Smiles

SPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCANPEKKWVQEYINYLEMS

Molecular Formula

20304 (Gene_ID) P30882 (S24-S91) (Accession)

Molecular Weight

40-45 kDa

References & Citations

[1]V Appay, et al. RANTES: a versatile and controversial chemokine. Trends Immunol. 2001 Feb;22 (2) :83-7.|[2]Zhen Zeng, et al. CCL5/CCR5 axis in human diseases and related treatments. Genes Dis. 2022 Jan;9 (1) :12-27.|[3]F Cocchi, et al. Identification of RANTES, MIP-1 alpha, and MIP-1 beta as the major HIV-suppressive factors produced by CD8+ T cells. Science. 1995 Dec 15;270 (5243) :1811-5.|[4]Sara González-Rodríguez, et al. Hyperalgesic and hypoalgesic mechanisms evoked by the acute administration of CCL5 in mice. Brain Behav Immun. 2017 May;62:151-161.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Galectin-4 Antibody (MM0300-1D12) [DyLight 488]
NBP2-12323G 0.1 mL

Mouse Monoclonal Galectin-4 Antibody (MM0300-1D12) [DyLight 488]

Sign In for Pricing
View Details
FAK1 discontinued
298699 100 µL

FAK1 discontinued

Sign In for Pricing
View Details
Cd93 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3380208 1.0 µg DNA

Cd93 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
hsa-miR-5583-3p Primers
MPH03273 150 µL / 10 µM

hsa-miR-5583-3p Primers

Sign In for Pricing
View Details
HSP90-IN-11
HY-146325 1 Each

HSP90-IN-11

Sign In for Pricing
View Details
Klhdc9 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6591202 1.0 µg DNA

Klhdc9 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details