Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFPI2, Mouse (HEK293, His)

TFPI2 (tissue factor pathway inhibitor 2) is a key regulator of matrix remodeling and has inhibitory control effects on trypsin, plasmin and factor VIIa/tissue factor.It has a weak effect on factor Xa and has no effect on thrombin.Its complex interactions extend to the formation of molecular complexes with ABCB1 and PPP2R3C, resulting in dephosphorylation of ABCB1.TFPI2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TFPI2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TFPI2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tfpi2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

LTSVSAQGNNLEICLLPLDAGPCQALIPKFYYDRDQQKCRRFNYGGCLGNANNFHSRDLCQQTCGSIEKVPPVCRSELKTYPCDKPNIRFFFNLNTMTCEPLRPGLCSRTINVFSEEATCKGLCEPRKHIPSFCSSPKDEGLCSANVTRFYFNSRNKTCETFTYTGCGGNENNFYYLDACHRACVKGWKKPKRWKIGDFLPRFWKHLS

Molecular Formula

21789 (Gene_ID) O35536 (L23-S230) (Accession)

Molecular Weight

35-50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Chlorobutyl Acetate
TRC-C364805-25G 25 g

4-Chlorobutyl Acetate

Sign In for Pricing
View Details
Frozen Tissue Sections, Pancreas
CS630223 5x 5 µm

Frozen Tissue Sections, Pancreas

Sign In for Pricing
View Details
5mL MacroTubes®
C2592 1 Each

5mL MacroTubes®

Sign In for Pricing
View Details
Quercetin 3-O-b-D Glucoside
TRC-Q509495-50MG 50 mg

Quercetin 3-O-b-D Glucoside

Sign In for Pricing
View Details
Apigenin
SIH-249-50MG 50 mg

Apigenin

Sign In for Pricing
View Details
Recombinant CCN2 Antibody
RN-14712-01 50 μL

Recombinant CCN2 Antibody

Sign In for Pricing
View Details