Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF164, Mouse

VEGF164 Protein, Mouse is a potent mediator of angiogenesis and binds the semaphorin receptor, neuropilin1.

Product Specifications

Product Name Alternative

VEGF164 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vegf165-protein-mouse.html

Purity

98.0

Smiles

MAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Molecular Formula

22339 (Gene_ID) Q00731-2 (A27-R190) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Usui T, et al. VEGF164 (165) as the pathological isoform: differential leukocyte and endothelial responses through VEGFR1 and VEGFR2. Invest Ophthalmol Vis Sci. 2004 Feb;45 (2) :368-74.|[2]Ishida S, et al. VEGF164 is proinflammatory in the diabetic retina. Invest Ophthalmol Vis Sci. 2003 May;44 (5) :2155-62.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cat Phospho Apoptosis Signal Regulating Kinase 1 (PASK1) ELISA Kit
MBS9344020 Inquire

Cat Phospho Apoptosis Signal Regulating Kinase 1 (PASK1) ELISA Kit

Sign In for Pricing
View Details
LTB4DH HDR Plasmid (h)
sc-409232-HDR 20 µg

LTB4DH HDR Plasmid (h)

Sign In for Pricing
View Details
Recombinant human SOCS-3 protein
ATGP2589-050 50 µg

Recombinant human SOCS-3 protein

Sign In for Pricing
View Details
Ceacam18 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
15808114 3x 1.0 µg

Ceacam18 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
GOLGA5 (Golgin Subfamily A Member 5, Cell Proliferation-inducing Gene 31 Protein, Golgin-84, Protein Ret-II, RET-fused Gene 5 Protein, RETII, RFG5, PIG31) (HRP)
127459-HRP 100 µL

GOLGA5 (Golgin Subfamily A Member 5, Cell Proliferation-inducing Gene 31 Protein, Golgin-84, Protein Ret-II, RET-fused Gene 5 Protein, RETII, RFG5, PIG31) (HRP)

Sign In for Pricing
View Details
Rabbit Polyclonal CDC37 Antibody [HRP]
NBP2-98936H 0.1 mL

Rabbit Polyclonal CDC37 Antibody [HRP]

Sign In for Pricing
View Details