Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kras4B, Human (G13C, His)

KRAS protein is a key Ras family member that binds GDP/GTP and has intrinsic GTPase activity. Its critical role in regulating cell proliferation emphasizes its importance in cellular processes. Kras4B Protein, Human (G13C, His) is the recombinant human-derived KRAS protein, expressed by E. coli , with N-6*His labeled tag and G13C mutation.

Product Specifications

Product Name Alternative

Kras4B Protein, Human (G13C, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kras-protein-human-g13c-his.html

Purity

95.0

Smiles

TEYKLVVVGAGCVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC

Molecular Formula

3845 (Gene_ID) AAH13572.1 (T2-C185, G13C) (Accession)

Molecular Weight

Approximately 25 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin Anti-Mouse CD3ε Antibody
RD21228F-01 25 µg

Biotin Anti-Mouse CD3ε Antibody

Sign In for Pricing
View Details
Biotin Anti-Mouse CD3ε Antibody
RD21228F-02 100 µg

Biotin Anti-Mouse CD3ε Antibody

Sign In for Pricing
View Details
ATP5LP6 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV757824 1.0 µg DNA

ATP5LP6 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
SPSB2-iNOS inhibitory cyclic peptide-1 (TFA)
HY-P10383A 1 Each

SPSB2-iNOS inhibitory cyclic peptide-1 (TFA)

Sign In for Pricing
View Details
Lpo (NM_080420) Mouse Tagged ORF Clone
MG210193 10 µg

Lpo (NM_080420) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
TFE3 Antibody (IHC Gold)
MBS8580255-01 0.1 mL

TFE3 Antibody (IHC Gold)

Sign In for Pricing
View Details