Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1QA, Mouse (His-SUMO)

The C1QA protein helps form C1, the starting component of the serum complement system. C1q binds to the zymogens C1r and C1s, resulting in C1 assembly. C1QA Protein, Mouse (His-SUMO) is the recombinant mouse-derived C1QA protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

C1QA Protein, Mouse (His-SUMO), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/c1qa-protein-mouse-his-sumo.html

Purity

95.00

Smiles

EDVCRAPNGKDGAPGNPGRPGRPGLKGERGEPGAAGIRTGIRGFKGDPGESGPPGKPGNVGLPGPSGPLGDSGPQGLKGVKGNPGNIRDQPRPAFSAIRQNPMTLGNVVIFDKVLTNQESPYQNHTGRFICAVPGFYYFNFQVISKWDLCLFIKSSSGGQPRDSLSFSNTNNKGLFQVLAGGTVLQLRRGDEVWIEKDPAKGRIYQGTEADSIFSGFLIFPSA

Molecular Formula

12259 (Gene_ID) P98086 (E23-A245) (Accession)

Molecular Weight

Approximately 42 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP27 (HSPB1) (NM_001540) Human Over-expression Lysate
LC400587 20 µg

HSP27 (HSPB1) (NM_001540) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human TNF-α Protein (Gst Tag)
PDEH100596-01 20 µg

Recombinant Human TNF-α Protein (Gst Tag)

Sign In for Pricing
View Details
Recombinant Human TNF-α Protein (Gst Tag)
PDEH100596-02 100 µg

Recombinant Human TNF-α Protein (Gst Tag)

Sign In for Pricing
View Details
Recombinant Human TNF-α Protein (Gst Tag)
PDEH100596-03 500 µg

Recombinant Human TNF-α Protein (Gst Tag)

Sign In for Pricing
View Details
Recombinant Human TNF-α Protein (Gst Tag)
PDEH100596-04 1 mg

Recombinant Human TNF-α Protein (Gst Tag)

Sign In for Pricing
View Details
EBF3 Rabbit Polyclonal Antibody
TA366628 100 µL

EBF3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details