Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-11, Mouse

IL-11 protein is a multifunctional cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation to increase platelet production. It also contributes to liver cell proliferation in response to liver injury. IL-11 Protein, Mouse is the recombinant mouse-derived IL-11 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IL-11 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-11-protein-mouse.html

Purity

96

Smiles

PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Molecular Formula

16156 (Gene_ID) P47873/NP_032376.1 (P22-L199) (Accession)

Molecular Weight

Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLEC18A (NM_182619) Human Untagged Clone
SC323880 10 µg

CLEC18A (NM_182619) Human Untagged Clone

Sign In for Pricing
View Details
BeyoGoldTM Adhesive Film for qPCR, Pressure Sensitive
FSF035-100pcs 100 PCS/Pack

BeyoGoldTM Adhesive Film for qPCR, Pressure Sensitive

Sign In for Pricing
View Details
DMRT2 Rabbit Polyclonal Antibody
TA329357 100 µL

DMRT2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rhbdf1 Mouse Gene Knockout Kit (CRISPR)
KN514752 1 Kit

Rhbdf1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IMQT_020
orb3174252-01 50 mg

IMQT_020

Sign In for Pricing
View Details
IMQT_020
orb3174252-02 10 mg

IMQT_020

Sign In for Pricing
View Details