Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Irisin, Human/Mouse/Rat (HEK293, His)

Irisin Protein is an important cytokine secreted by muscles during exercise, which has multiple functions such as regulating metabolism and improving health. Irisin Protein, Human/Mouse/Rat (HEK293, His) is a recombinant Irisin Protein expressed by HEK293 and carrying a C-6*His tag[1][2][3].

Product Specifications

Product Name Alternative

Irisin Protein, Human/Mouse/Rat (HEK293, His), Mouse; Rat; Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/irisin-protein-human-mouse-rat-hek293-his.html

Purity

98.0

Smiles

DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE

Molecular Formula

252995 (Gene_ID) Q8NAU1-1 (D32-E143) (Accession)

Molecular Weight

Approximately 18-28 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Hyeonwoo Kim, et al. Irisin Mediates Effects on Bone and Fat via αV Integrin Receptors. Cell.|[2]Polyzos SA, et al. Irisin in metabolic diseases. Endocrine. 2018 Feb;59 (2) :260-274.|[3]Liu S, et al. Role of irisin in physiology and pathology. Front Endocrinol (Lausanne) . 2022 Sep 26;13:962968.|[4]Li T, et al. Irisin suppresses pancreatic β cell pyroptosis in T2DM by inhibiting the NLRP3-GSDMD pathway and activating the Nrf2-TrX/TXNIP signaling axis. Diabetol Metab Syndr. 2023 Nov 22;15 (1) :239.|[5]Wang C, et al. Irisin inhibits microglial senescence via TFAM-mediated mitochondrial metabolism in a mouse model of tauopathy. Immun Ageing. 2024 May 14;21 (1) :30.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral human FAM53A shRNA (UAS) - Lentiviral human FAM53A shRNA (UAS, RFP) plasmid
GTR15132721 1 Vial

Lentiviral human FAM53A shRNA (UAS) - Lentiviral human FAM53A shRNA (UAS, RFP) plasmid

Ask
View Details
MIR143 Human MicroRNA Expression Plasmid (MI0000459)
SC400173 10 µg

MIR143 Human MicroRNA Expression Plasmid (MI0000459)

Ask
View Details
STRIP2 siRNA (Mouse)
CRN4452-01 15 nmol

STRIP2 siRNA (Mouse)

Ask
View Details
STRIP2 siRNA (Mouse)
CRN4452-02 30 nmol

STRIP2 siRNA (Mouse)

Ask
View Details
Ephb1 (Ephrin Type-B Receptor 1, Ephb1) (MaxLight 650)
MBS6455840-01 0.1 mL

Ephb1 (Ephrin Type-B Receptor 1, Ephb1) (MaxLight 650)

Ask
View Details
Ephb1 (Ephrin Type-B Receptor 1, Ephb1) (MaxLight 650)
MBS6455840-02 5x 0.1 mL

Ephb1 (Ephrin Type-B Receptor 1, Ephb1) (MaxLight 650)

Ask
View Details