Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LGR4, Human (HEK293, His)

The Lgr4/GPR48 protein is a receptor for R-spondins that activates the canonical Wnt pathway and is critical for organ development (liver, kidney, intestine, bone, reproductive tract, and eye) . Lgr4/GPR48 binds R-spondins (RSPO1-4), binds to phosphorylated LRP6 and Frizzled receptors, and initiates Wnt signaling without activating G proteins. Lgr4/GPR48 Protein, Human (HEK293, His) is the recombinant human-derived Lgr4/GPR48 protein, expressed by HEK293, with C-His labeled tag.

Product Specifications

Product Name Alternative

Lgr4/GPR48 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Purity

85

Smiles

APPLCAAPCSCDGDRRVDCSGKGLTAVPEGLSAFTQALDISMNNITQLPEDAFKNFPFLEELQLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTVPSEAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNSLTEVPVHPLSNLPTLQALTLALNKISSIPDFAFTNLSSLVVLHLHNNKIRSLSQHCFDGLDNLETLDLNYNNLGEFPQAIKALPSLKELGFHSNSISVIPDGAFDGNPLLRTIHLYDNPLSFVGNSAFHNLSDLHSLVIRGASMVQQFPNLTGTVHLESLTLTGTKISSIPNNLCQEQKMLRTLDLSYNNIRDLPSFNGCHALEEISLQRNQIYQIKEGTFQGLISLRILDLSRNLIHEIHSRAFATLGPITNLDVSFNELTSFPTEGLNGLNQLKLVGNFKLKEALAAKDFVNLRSLSVPYAYQCCAFWGCDSYANLNTEDNSLQDHSVAQEKGTADAANVTSTLENEEHSQIIIHCTPSTGAFKPCEYLLGSWMIRLT

Molecular Formula

55366 (Gene_ID) Q9BXB1-1 (A25-T544) (Accession)

Molecular Weight

Approximately 70-100 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC100039031 3'UTR GFP Stable Cell Line
TU161143 1.0 mL

LOC100039031 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
(6R,7S,8a-rac) - (4'-Desamino) Glucosepane discontinued. See 439095
439094-01 500 µg

(6R,7S,8a-rac) - (4'-Desamino) Glucosepane discontinued. See 439095

Sign In for Pricing
View Details
(6R,7S,8a-rac) - (4'-Desamino) Glucosepane discontinued. See 439095
439094-02 1 mg

(6R,7S,8a-rac) - (4'-Desamino) Glucosepane discontinued. See 439095

Sign In for Pricing
View Details
Sptb Mouse shRNA Lentiviral Particle (Locus ID 20741)
TL513981V 500 µL Each

Sptb Mouse shRNA Lentiviral Particle (Locus ID 20741)

Sign In for Pricing
View Details
Recombinant Fumarate reductase subunit C (frdC)
MBS7015039-01 0.02 mg

Recombinant Fumarate reductase subunit C (frdC)

Sign In for Pricing
View Details
Recombinant Fumarate reductase subunit C (frdC)
MBS7015039-02 0.1 mg

Recombinant Fumarate reductase subunit C (frdC)

Sign In for Pricing
View Details