Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LGR4, Human (HEK293, His)

The Lgr4/GPR48 protein is a receptor for R-spondins that activates the canonical Wnt pathway and is critical for organ development (liver, kidney, intestine, bone, reproductive tract, and eye) . Lgr4/GPR48 binds R-spondins (RSPO1-4), binds to phosphorylated LRP6 and Frizzled receptors, and initiates Wnt signaling without activating G proteins. Lgr4/GPR48 Protein, Human (HEK293, His) is the recombinant human-derived Lgr4/GPR48 protein, expressed by HEK293, with C-His labeled tag.

Product Specifications

Product Name Alternative

Lgr4/GPR48 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Purity

85

Smiles

APPLCAAPCSCDGDRRVDCSGKGLTAVPEGLSAFTQALDISMNNITQLPEDAFKNFPFLEELQLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTVPSEAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNSLTEVPVHPLSNLPTLQALTLALNKISSIPDFAFTNLSSLVVLHLHNNKIRSLSQHCFDGLDNLETLDLNYNNLGEFPQAIKALPSLKELGFHSNSISVIPDGAFDGNPLLRTIHLYDNPLSFVGNSAFHNLSDLHSLVIRGASMVQQFPNLTGTVHLESLTLTGTKISSIPNNLCQEQKMLRTLDLSYNNIRDLPSFNGCHALEEISLQRNQIYQIKEGTFQGLISLRILDLSRNLIHEIHSRAFATLGPITNLDVSFNELTSFPTEGLNGLNQLKLVGNFKLKEALAAKDFVNLRSLSVPYAYQCCAFWGCDSYANLNTEDNSLQDHSVAQEKGTADAANVTSTLENEEHSQIIIHCTPSTGAFKPCEYLLGSWMIRLT

Molecular Formula

55366 (Gene_ID) Q9BXB1-1 (A25-T544) (Accession)

Molecular Weight

Approximately 70-100 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

pHY-P43 Plasmid
PVTY00045 2 µg

pHY-P43 Plasmid

Sign In for Pricing
View Details
Recombinant Mouse MUT Protein, His (Fc)-Avi-tagged
MUT-5818M 50 µg

Recombinant Mouse MUT Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
ACVR1C sgRNA CRISPR Lentivector (Human) (Target 3)
K0039604 1.0 µg DNA

ACVR1C sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
SLC6A14 Rabbit pAb (APR18196N)
APR18196N-01 50 µL

SLC6A14 Rabbit pAb (APR18196N)

Sign In for Pricing
View Details
SLC6A14 Rabbit pAb (APR18196N)
APR18196N-02 100 µL

SLC6A14 Rabbit pAb (APR18196N)

Sign In for Pricing
View Details
SLC6A14 Rabbit pAb (APR18196N)
APR18196N-03 200 µL

SLC6A14 Rabbit pAb (APR18196N)

Sign In for Pricing
View Details