Question 1

What is the catalog number for SGEF Protein Vector (Human) (pPB-C-His)?

Accepted Answer

The catalog number for SGEF Protein Vector (Human) (pPB-C-His) is PV037841.

Question 2

Is SGEF Protein Vector (Human) (pPB-C-His) in stock?

Accepted Answer

SGEF Protein Vector (Human) (pPB-C-His) is currently made to order / not held in immediate stock. Contact us for lead time.

Question 3

Is this product suitable for live cell imaging?

Accepted Answer

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.

Question 4

Is this product covered by a money-back guarantee?

Accepted Answer

Yes, we guarantee a full refund or store credit if this product arrives damaged beyond usability, or has a genuine performance issue under proper usage and storage, provided you report it immediately with evidence. Claims after the expiration date or due to improper storage after receipt are excluded.

Question 5

Can this product be used for diagnostic or therapeutic purposes?

Accepted Answer

No. This product, like all items we supply, is intended for research laboratory use only and must not be used for diagnostics, therapeutics, treatment, or consumption by humans or animals.

SGEF Protein Vector (Human) (pPB-C-His)

Product Specifications

Frequently Asked Questions

Explore Other Products

mmu-miR-3078-3p Primers

CW 008

CW 008

H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH

H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH

H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH