Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Ketohexokinase (Khk)

Product Specifications

Product Name Alternative

Ketohexokinase (EC 2.7.1.3) (Hepatic fructokinase)

Abbreviation

Recombinant Mouse Khk protein

Gene Name

Khk

UniProt

P97328

Expression Region

1-298aa

Organism

Mus musculus (Mouse)

Target Sequence

MEEKQILCVGLVVLDIINVVDKYPEEDTDRRCLSQRWQRGGNASNSCTVLSLLGARCAFMGSLAPGHVADFLVADFRQRGVDVSQVTWQSQGDTPCSCCIVNNSNGSRTIILYDTNLPDVSAKDFEKVDLTRFKWIHIEGRNASEQVKMLQRIEEHNAKQPLPQKVRVSVEIEKPREELFQLFSYGEVVFVSKDVAKHLGFQPAVEALRGLYSRVKKGATLVCAWAEEGADALGPDGQLLHSDAFPPPRVVDTLGAGDTFNASVIFSLSKGNSMQEALRFGCQVAGKKCGLQGFDGIV

Tag

N-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Catalyzes the phosphorylation of the ketose sugar fructose to fructose-1-phosphate.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

36.4 kDa

References & Citations

"Global survey of organ and organelle protein expression in mouse: combined proteomic and transcriptomic profiling." Kislinger T., Cox B., Kannan A., Chung C., Hu P., Ignatchenko A., Scott M.S., Gramolini A.O., Morris Q., Hallett M.T., Rossant J., Hughes T.R., Frey B., Emili A. Cell 125:173-186 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MART-1 / Melan-A (M2-7C10 + M2-9E3 + A103), CF640R conjugate, 0.1mg/mL
BNC400700-500 1x 500 µL

MART-1 / Melan-A (M2-7C10 + M2-9E3 + A103), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary
CS700181 5x 5 µm

Tissue FFPE Sections, Ovary

Sign In for Pricing
View Details
CD45 / LCA (Leucocyte Marker) (PTPRC/1147 + PTPRC/1460), CF594 conjugate, 0.1mg/mL
BNC942027-100 1x 100 µL

CD45 / LCA (Leucocyte Marker) (PTPRC/1147 + PTPRC/1460), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Apolipoprotein A V (APOA5) Mouse Monoclonal Antibody [Clone ID: 1G5G9 (c)]
AM06076PU-N 100 µL

Apolipoprotein A V (APOA5) Mouse Monoclonal Antibody [Clone ID: 1G5G9 (c)]

Sign In for Pricing
View Details
Oleamide
SIH-627-250MG 250 mg

Oleamide

Sign In for Pricing
View Details
Kallikrein 12 (KLK12) Rabbit Polyclonal Antibody
TA371979 100 µL

Kallikrein 12 (KLK12) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details